TkA06G017240 | RubberDandelionOmics

Gene overview

TkA06G017240

Reference: TK1151 Chr: Chr06 Coordinates: 4692926-4695530 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2214 bp · TkA06G017240|TK1151|cDNA

ATGGGCGTTCCGAATCCTTCAAAGCCATTAAAGCCTCTAAGACCCGAATACTGTTCAGAAGTGGAACTCGGTGAATCACAGTGGATAAACTGCGACATACGCAACTTCAGAATGGACATATTAGGACAATACGGAGTGATAATGGCGGACCCACCATGGGACATTCACATGGAGCTACCTTACGGCACCATGGCTGATGACGAAATGCGTAATCTCAACATCCAAGCTTTACAAACCGACGGTCTTATCTTTCTCTGGGT...

CDS

Download CDS FASTA

726 bp · TkA06G017240|TK1151|CDS

ATGGGCGTTCCGAATCCTTCAAAGCCATTAAAGCCTCTAAGACCCGAATACTGTTCAGAAGTGGAACTCGGTGAATCACAGTGGATAAACTGCGACATACGCAACTTCAGAATGGACATATTAGGACAATACGGAGTGATAATGGCGGACCCACCATGGGACATTCACATGGAGCTACCTTACGGCACCATGGCTGATGACGAAATGCGTAATCTCAACATCCAAGCTTTACAAACCGACGGTCTTATCTTTCTCTGGGT...

Protein

Download Protein FASTA

241 aa · TkA06G017240|TK1151|PROTEIN

MGVPNPSKPLKPLRPEYCSEVELGESQWINCDIRNFRMDILGQYGVIMADPPWDIHMELPYGTMADDEMRNLNIQALQTDGLIFLWVTGRAMELGRRTGHWLNHSKEHCLVGIKGDPIVNRNIDTDVIVAEVRETSRKPDEMYPLLERISPRTRKLELFARMHNTHAGWMSLGNQLSGARLVDDGLRARFKAAYPEVDVQPLSPPRASAMELETSPFSGADVRPSDPIYETSPWMNLDVEI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G017240`
TK1151 ID	TkA06G017240
OH-1004 ID	LXL04_026270
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.500
Protein coverage (%)	TK1151 96.680 / OH-1004 37.006 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G017240

Location Chr06:4692926-4695530 (+)

Description Similar to MTA: N6-adenosine-methyltransferase MT-A70-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10760`	Catalytic subunit of the N6-methyltransferase complex, a multiprotein complex that mediates N6-methyladenosine (m6A) methylation at the 5'-[AG]GAC-3' consensus sites of some mRNAs.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0672600`	Probable N6-methyltransferase that methylates adenosine residues of some mRNAs.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026270 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0001510 RNA methylation Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006402 mRNA catabolic process Biological Process

GO:0006406 mRNA export from nucleus Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0016556 mRNA modification Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0031053 primary miRNA processing Biological Process

KEGG gene cross-reference

ath:AT4G10760

dosa:Os02g0672600

hsa:56339

mmu:56335

mtr:11429893

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.593

Rank 1 · TkA06G017240 · TK1151

Cytoplasm0.504

Rank 2 · TkA06G017240 · TK1151

Mitochondrion0.068

Rank 3 · TkA06G017240 · TK1151

Cell membrane0.047

Rank 4 · TkA06G017240 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA06G017240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05063MT-A7044-95 aa

PF05063MT-A7097-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G017240	`PF05063`	MT-A70	44	95	1.2e-42	146.4
TkA06G017240	`PF05063`	MT-A70	97	175	1.2e-42	146.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82486`	Arabidopsis thaliana	sp\|O82486\|MTA70_ARATH N(6)-adenosine-methyltransferase MT-A70-like	73.100%	Swiss-Prot	High
`Q6EU10`	Oryza sativa subsp. japonica	sp\|Q6EU10\|MTA70_ORYSJ Probable N(6)-adenosine-methyltransferase MT-A70-like	75.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card