TkA06G016010 | RubberDandelionOmics

Gene overview

TkA06G016010

Reference: TK1151 Chr: Chr06 Coordinates: 4316313-4318260 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

994 bp · TkA06G016010|TK1151|cDNA

CGTCTCTCTCTTTCTCTCACACCCAAGTTCATCCACAGTCATGGTTTCAGCCGATTTTGCTCGCAATCTTCTTGGTATCATAGGGAATGTCATTTCAATCATTTTGTTCTTATCTACAATGCCAACGTTTTACAGGATATGGAAAAACAAGTCAGTCGAAAGATTTTCTCCAATCCCATATCTCGTCACCTTTGTGAATTGTGGGCTATGGATTTTCTACGGCTTGCCTTTGGTGCACCCTAATAGTTTACTAGTCACCA...

CDS

Download CDS FASTA

732 bp · TkA06G016010|TK1151|CDS

ATGGTTTCAGCCGATTTTGCTCGCAATCTTCTTGGTATCATAGGGAATGTCATTTCAATCATTTTGTTCTTATCTACAATGCCAACGTTTTACAGGATATGGAAAAACAAGTCAGTCGAAAGATTTTCTCCAATCCCATATCTCGTCACCTTTGTGAATTGTGGGCTATGGATTTTCTACGGCTTGCCTTTGGTGCACCCTAATAGTTTACTAGTCACCACCACAAATGGTGCAGGAATAATCATCGAGTCTTTTTATTT...

Protein

Download Protein FASTA

243 aa · TkA06G016010|TK1151|PROTEIN

MVSADFARNLLGIIGNVISIILFLSTMPTFYRIWKNKSVERFSPIPYLVTFVNCGLWIFYGLPLVHPNSLLVTTTNGAGIIIESFYLILFIIYSDQKKRIRVLLVLLAEIIFLGVLVVLVLNFAHTTKLRSAIVGGISVGGNIMMYASPLSVMKMVITTKSVEYMPFLLSLFCFANGVCWFSYALIRFDPFVAVPNGLGALFGLAQLILYATFYKSTQEIIARRQDKSELVIGNVGTSQVEEV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G016010`
TK1151 ID	TkA06G016010
OH-1004 ID	LXL04_026293
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.588 / OH-1004 63.684 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G016010

Location Chr06:4316313-4318260 (-)

Description Similar to SWEET6B: Bidirectional sugar transporter SWEET6b

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0605700`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`UniProt: A2WSD3`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`UniProt: A2WSD8`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`Os01g0606000`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release
`UniProt: A2X3S3`	Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026293 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008643 carbohydrate transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0051119 sugar transmembrane transporter activity Molecular Function

KEGG gene cross-reference

dosa:Os01g0605700

dosa:Os01g0606000

dosa:Os09g0258700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.740

Rank 1 · TkA06G016010 · TK1151

Cytoplasm0.103

Rank 2 · TkA06G016010 · TK1151

Endoplasmic reticulum0.088

Rank 3 · TkA06G016010 · TK1151

Lysosome / Vacuole0.085

Rank 4 · TkA06G016010 · TK1151

Golgi apparatus0.054

Rank 5 · TkA06G016010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30622DUF86768-37 aa

PF03083MtN3_slv10-98 aa

PF04193PQ-loop12-60 aa

PF20556DUF676812-41 aa

PF04193PQ-loop76-88 aa

PF20556DUF676897-145 aa

PF03083MtN3_slv133-217 aa

PF30622DUF8676148-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G016010	`PF30622`	DUF8676	8	37	0.015	15.9
TkA06G016010	`PF03083`	MtN3_slv	10	98	9.2e-46	154.5
TkA06G016010	`PF04193`	PQ-loop	12	60	0.0068	16.9
TkA06G016010	`PF20556`	DUF6768	12	41	7.1	7.1
TkA06G016010	`PF04193`	PQ-loop	76	88	0.0068	16.9
TkA06G016010	`PF20556`	DUF6768	97	145	7.1	7.1
TkA06G016010	`PF03083`	MtN3_slv	133	217	9.2e-46	154.5
TkA06G016010	`PF30622`	DUF8676	148	170	0.015	15.9
TkA06G016010	`PF04193`	PQ-loop	158	191	0.0068	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W0K2`	Oryza sativa subsp. japonica	sp\|Q8W0K2\|SWT6B_ORYSJ Bidirectional sugar transporter SWEET6b	59.900%	Swiss-Prot	High
`A2WSD3`	Oryza sativa subsp. indica	sp\|A2WSD3\|SWT6B_ORYSI Bidirectional sugar transporter SWEET6b	58.500%	Swiss-Prot	High
`A2WSD8`	Oryza sativa subsp. indica	sp\|A2WSD8\|SWT6A_ORYSI Bidirectional sugar transporter SWEET6a	58.500%	Swiss-Prot	High
`Q8LR09`	Oryza sativa subsp. japonica	sp\|Q8LR09\|SWT6A_ORYSJ Bidirectional sugar transporter SWEET6a	58.500%	Swiss-Prot	High
`A2X3S3`	Oryza sativa subsp. indica	sp\|A2X3S3\|SWET4_ORYSI Bidirectional sugar transporter SWEET4	55.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card