TkA06G015470 | RubberDandelionOmics

Gene overview

TkA06G015470

Reference: TK1151 Chr: Chr06 Coordinates: 4197264-4197710 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

447 bp · TkA06G015470|TK1151|cDNA

ATGAACTCAAGATCAGTGGCGGCGCCGGTGGTCGTCAAATGTGAAAACCTTATGAAGAACTGTTCATCTTCATCGCAGGCCTACAAAACCCTAACATCTGCAGTGGGGTGTGACCCTGACGCGATGGTGCGCTCTGCCTGTGTTGCCGCTACCAGCTCCATCGCGTCTCACATCACAAAACCTCCGGTAGCGAAGCCCTTGGTGGACGCGTTGGTGAACTCTCAAATCGGCGCGGCTTTGTGCTTGGGCGCGGTTATCAA...

CDS

Download CDS FASTA

447 bp · TkA06G015470|TK1151|CDS

ATGAACTCAAGATCAGTGGCGGCGCCGGTGGTCGTCAAATGTGAAAACCTTATGAAGAACTGTTCATCTTCATCGCAGGCCTACAAAACCCTAACATCTGCAGTGGGGTGTGACCCTGACGCGATGGTGCGCTCTGCCTGTGTTGCCGCTACCAGCTCCATCGCGTCTCACATCACAAAACCTCCGGTAGCGAAGCCCTTGGTGGACGCGTTGGTGAACTCTCAAATCGGCGCGGCTTTGTGCTTGGGCGCGGTTATCAA...

Protein

Download Protein FASTA

148 aa · TkA06G015470|TK1151|PROTEIN

MNSRSVAAPVVVKCENLMKNCSSSSQAYKTLTSAVGCDPDAMVRSACVAATSSIASHITKPPVAKPLVDALVNSQIGAALCLGAVINGARDPDTPYLRRLLPRIFFERRLGAAGSDIRSGCIPCNPADPGSIPLRGDNNIILGDPVSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G015470`
TK1151 ID	TkA06G015470
OH-1004 ID	LXL04_005700
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.200
Protein coverage (%)	TK1151 81.757 / OH-1004 88.194 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G015470`
Location	Chr06:4197264-4197710 (-)
Description	Similar to TOR1L4: TORTIFOLIA1-like protein 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005700` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005634 nucleus Cellular Component GO:0005874 microtubule Cellular Component GO:0009507 chloroplast Cellular Component GO:0008017 microtubule binding Molecular Function
KEGG gene cross-reference	ath:AT1G27210 ath:AT1G59850 ath:AT2G07170 ath:AT5G62580 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.448

Rank 1 · TkA06G015470 · TK1151

Nucleus0.398

Rank 2 · TkA06G015470 · TK1151

Mitochondrion0.126

Rank 3 · TkA06G015470 · TK1151

Cell membrane0.071

Rank 4 · TkA06G015470 · TK1151

Extracellular0.066

Rank 5 · TkA06G015470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13513HEAT_EZ24-50 aa

PF13646HEAT_224-72 aa

PF02985HEAT31-57 aa

PF24714TOR1L1_N38-104 aa

PF13513HEAT_EZ77-83 aa

PF13513HEAT_EZ77-103 aa

PF13646HEAT_277-99 aa

PF02985HEAT78-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G015470	`PF13513`	HEAT_EZ	24	50	0.0073	17.5
TkA06G015470	`PF13646`	HEAT_2	24	72	0.011	16.8
TkA06G015470	`PF02985`	HEAT	31	57	0.016	16.1
TkA06G015470	`PF24714`	TOR1L1_N	38	104	6.1e-14	52.8
TkA06G015470	`PF13513`	HEAT_EZ	77	83	0.0073	17.5
TkA06G015470	`PF13513`	HEAT_EZ	77	103	0.0073	17.5
TkA06G015470	`PF13646`	HEAT_2	77	99	0.011	16.8
TkA06G015470	`PF02985`	HEAT	78	86	0.016	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card