TkA06G014790 | RubberDandelionOmics

Gene overview

TkA06G014790

Reference: TK1151 Chr: Chr06 Coordinates: 3960853-3961274 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

381 bp · TkA06G014790|TK1151|cDNA

ATGGCGATGGCAACCACCATAAACAACGGCGACAAGGTTATGCTGCTAGAAGCTCCGCCATCTTCCCGGCCTTCTTGGTCCAGTAGTGCAGCGCAGATCGACGCATTGCCCTACATAGACGACGAATACGGCGACCCCAAAGTGAAAGCGGAAGTCGACCGTTCAATTGAAGACGAGATGCGCCGTAGCTCTAAGAAACCCTCTGATTATCTAAAAGACCTCCCTCCTGTTGCCAAGGTTTTACTATCTTCCCCCTTCGT...

CDS

Download CDS FASTA

381 bp · TkA06G014790|TK1151|CDS

ATGGCGATGGCAACCACCATAAACAACGGCGACAAGGTTATGCTGCTAGAAGCTCCGCCATCTTCCCGGCCTTCTTGGTCCAGTAGTGCAGCGCAGATCGACGCATTGCCCTACATAGACGACGAATACGGCGACCCCAAAGTGAAAGCGGAAGTCGACCGTTCAATTGAAGACGAGATGCGCCGTAGCTCTAAGAAACCCTCTGATTATCTAAAAGACCTCCCTCCTGTTGCCAAGGTTTTACTATCTTCCCCCTTCGT...

Protein

Download Protein FASTA

126 aa · TkA06G014790|TK1151|PROTEIN

MAMATTINNGDKVMLLEAPPSSRPSWSSSAAQIDALPYIDDEYGDPKVKAEVDRSIEDEMRRSSKKPSDYLKDLPPVAKVLLSSPFVFPSIGFRRAFRRVTGEIGRGKEGGRIYDFVGQCTLTYDT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G014790`
TK1151 ID	TkA06G014790
OH-1004 ID	LXL04_002992
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 62.698 / OH-1004 31.225 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G014790

Location Chr06:3960853-3961274 (-)

Description Similar to MOS4: Pre-mRNA-splicing factor SPF27 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18165`	Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity.	Regulation of plant innate immunity by three proteins in a complex conserved across the plant and animal kingdoms.2007 · DOI: 10.1101/gad.1559607

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002992 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000375 RNA splicing, via transesterification reactions Biological Process

GO:0000380 alternative mRNA splicing, via spliceosome Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051225 spindle assembly Biological Process

GO:0097061 dendritic spine organization Biological Process

GO:0000974 Prp19 complex Cellular Component

KEGG gene cross-reference

ath:AT3G18165

dre:493614

hsa:10286

mmu:68183

xtr:394520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.295

Rank 1 · TkA06G014790 · TK1151

Cytoplasm0.238

Rank 2 · TkA06G014790 · TK1151

Cell membrane0.203

Rank 3 · TkA06G014790 · TK1151

Endoplasmic reticulum0.151

Rank 4 · TkA06G014790 · TK1151

Plastid0.134

Rank 5 · TkA06G014790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05700BCAS232-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G014790	`PF05700`	BCAS2	32	86	1.8e-12	48.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949S9`	Arabidopsis thaliana	sp\|Q949S9\|SPF27_ARATH Pre-mRNA-splicing factor SPF27 homolog	63.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card