TkA06G014660 | RubberDandelionOmics

Gene overview

TkA06G014660

Reference: TK1151 Chr: Chr06 Coordinates: 3916355-3918693 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1637 bp · TkA06G014660|TK1151|cDNA

TAAGTTGCAAACAAACAAATATTATTAAAAGAGAAAAACAATAAAACCTCCCGGTAAGTTATCCCCTTGCAATTTATTGTAAAAAAACCTCTCAGTAGGGTTTTTATTTTTAGCCATGGCTCCAAAATATCATGATTTTGGTACTAATTTTCTCTAAATCGATATGTTCTAGCTCGATTCTCGTTTTGGACGGAAAAGGAACACTCTAATCACCAATTAATGAAGCTTCTTTTCACCAAATGGATGAATTAGTGGGAAAC...

CDS

Download CDS FASTA

1398 bp · TkA06G014660|TK1151|CDS

ATGGATGAATTAGTGGGAAACGAGGCAACTACAGTTAATGACATTGATAACAAACGGTTCTTAAAGCGTGGAAGAAGCTCAAACATGCTTGAAATGCAGGAAATGCTTATACCTGATGATGTTAACCTTCAAGACAACACAATGGGGGTGTATTTAGACGGAAAAAACGTATCTAGGGTTGACACGTCAGCACATGCATGCACAAGCCCACGTTGTGTGAACGATTCAGGGACTATAATTGAAGAATTAACCGTAAAAAG...

Protein

Download Protein FASTA

466 aa · TkA06G014660|TK1151|PROTEIN

MDELVGNEATTVNDIDNKRFLKRGRSSNMLEMQEMLIPDDVNLQDNTMGVYLDGKNVSRVDTSAHACTSPRCVNDSGTIIEELTVKSYDSGKLEIDASNMRGNKTQNNWQHLNRKPEGITPGVWEDSGSTIFPELLNNNNNNQESENKNDENAPSRREDKQPVSGTNTLMSPGGIRTKILSQSGFSQFFVKSTLKGKGVICSGSPRVQNPPPTPVIDSSKETTVGVTLHDSLSLREWLKGGLNKVDKSKSLYIFKQILDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G014660`
TK1151 ID	TkA06G014660
OH-1004 ID	LXL04_037649
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	33.500
Protein coverage (%)	TK1151 50.000 / OH-1004 26.316 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G014660

Location Chr06:3916355-3918693 (+)

Description Similar to SPA3: Protein SPA1-RELATED 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11110`	Involved in suppression of photomorphogenesis in dark-grown seedlings.	The SPA quartet: a family of WD-repeat proteins with a central role in suppression of photomorphogenesis in arabidopsis.2004 · DOI: 10.1105/tpc.104.024216 Functional and expression analysis of Arabidopsis SPA genes during seedling photomorphogenesis and adult growth.2006 · DOI: 10.1111/j.1365-313x.2006.02812.x
`UniProt: Q9SYX2`	Controls normal photoperiodic flowering and regulates circadian rhythms.	No verified direct reference in this release
`At3g15354`	Repressor of photomorphogenesis in the light.	The SPA1-like proteins SPA3 and SPA4 repress photomorphogenesis in the light.2003 · DOI: 10.1046/j.1365-313x.2003.01813.x Functional and expression analysis of Arabidopsis SPA genes during seedling photomorphogenesis and adult growth.2006 · DOI: 10.1111/j.1365-313x.2006.02812.x Arabidopsis SPA proteins regulate photoperiodic flowering and interact with the floral inducer CONSTANS to regulate its stability.2006 · DOI: 10.1242/dev.02481
`At1g53090`	Repressor of photomorphogenesis in the light.	The SPA1-like proteins SPA3 and SPA4 repress photomorphogenesis in the light.2003 · DOI: 10.1046/j.1365-313x.2003.01813.x Functional and expression analysis of Arabidopsis SPA genes during seedling photomorphogenesis and adult growth.2006 · DOI: 10.1111/j.1365-313x.2006.02812.x Arabidopsis SPA proteins regulate photoperiodic flowering and interact with the floral inducer CONSTANS to regulate its stability.2006 · DOI: 10.1242/dev.02481

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037649 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0009585 red, far-red light phototransduction Biological Process

GO:0009637 response to blue light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009641 shade avoidance Biological Process

GO:0009647 skotomorphogenesis Biological Process

GO:0009649 entrainment of circadian clock Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010100 negative regulation of photomorphogenesis Biological Process

GO:0010114 response to red light Biological Process

KEGG gene cross-reference

ath:AT1G53090

ath:AT2G32950

ath:AT2G46340

ath:AT3G15354

ath:AT4G11110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.567

Rank 1 · TkA06G014660 · TK1151

Cytoplasm0.341

Rank 2 · TkA06G014660 · TK1151

Cell membrane0.141

Rank 3 · TkA06G014660 · TK1151

Endoplasmic reticulum0.052

Rank 4 · TkA06G014660 · TK1151

Golgi apparatus0.039

Rank 5 · TkA06G014660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase234-300 aa

PF07714PK_Tyr_Ser-Thr382-417 aa

PF00069Pkinase385-434 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G014660	`PF00069`	Pkinase	234	300	0.0043	17.2
TkA06G014660	`PF07714`	PK_Tyr_Ser-Thr	382	417	0.046	13.8
TkA06G014660	`PF00069`	Pkinase	385	434	0.0043	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9T014`	Arabidopsis thaliana	sp\|Q9T014\|SPA2_ARATH Protein SPA1-RELATED 2	34.700%	Swiss-Prot	Medium
`Q9SYX2`	Arabidopsis thaliana	sp\|Q9SYX2\|SPA1_ARATH Protein SUPPRESSOR OF PHYA-105 1	31.900%	Swiss-Prot	Medium
`Q9LJR3`	Arabidopsis thaliana	sp\|Q9LJR3\|SPA3_ARATH Protein SPA1-RELATED 3	32.500%	Swiss-Prot	Medium
`Q94BM7`	Arabidopsis thaliana	sp\|Q94BM7\|SPA4_ARATH Protein SPA1-RELATED 4	31.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card