TkA06G014220 | RubberDandelionOmics

Gene overview

TkA06G014220

Reference: TK1151 Chr: Chr06 Coordinates: 3769051-3774032 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2407 bp · TkA06G014220|TK1151|cDNA

CCCATCTAGCTGCCGTGTCTTCAACTTCTTTCCTATCTTATCGACTTCTGTGGGTAGAGAAATGTTACACGCAGAACACCTCCTATCGTTTTATCCTTAAGGATATCAGACGCGGGAGTTGGACGCCTCGTCTTCATCATCTTCATTTATTTGGATTAGGCGTGCCCTGGTTCTGGTGCTTAGAAGAACGAGAAGTCAGAAGCATGCTGGCGGGAAGTTTAATTCTAATTGCTGCCTGAATTGGGACTTAGGTCTCCCCT...

CDS

Download CDS FASTA

573 bp · TkA06G014220|TK1151|CDS

ATGGTAATCACTGGACACGATGACGGTACAGGTTCATCGGAGTACGATTACATTAGGAGACACCATAAGCACGAGGTTAGAGACAACCAGTGCACTTCGTCTCTCGTTAAACACATCAAAGCGCCTGTTCACCTTGTATGGTCTTTGGTGAGGAGGTTTGACCAACCACAGAAGTACAAACCGTTTGTTAGTGGATGCAATGTTCAAGGTGAAGGTGAACTTGAAATCGGAAGTGTGAGAGAAGTGAATGTCAGATCTGG...

Protein

Download Protein FASTA

190 aa · TkA06G014220|TK1151|PROTEIN

MVITGHDDGTGSSEYDYIRRHHKHEVRDNQCTSSLVKHIKAPVHLVWSLVRRFDQPQKYKPFVSGCNVQGEGELEIGSVREVNVRSGLPATTSMERLELLNEEEHILGIRIVGGDHRLRNYSSVITLHPEIIEGRPGTLVIESFVVDVPDGNTKDETCYFVEALIKCNLKSLADVSERLAVQDRTESIVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G014220`
TK1151 ID	TkA06G014220
OH-1004 ID	LXL04_026354
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G014220

Location Chr06:3769051-3774032 (+)

Description Similar to PYL8: Abscisic acid receptor PYL8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53160`	Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition.	Closely related receptor complexes differ in their ABA selectivity and sensitivity.2010 · DOI: 10.1111/j.1365-313x.2009.04025.x The nuclear interactor PYL8/RCAR3 of Fagus sylvatica FsPP2C1 is a positive regulator of abscisic acid signaling in seeds and stress.2010 · DOI: 10.1104/pp.109.146381
`At1g01360`	Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition.	Regulators of PP2C phosphatase activity function as abscisic acid sensors.2009 · DOI: 10.1126/science.1172408
`At4g01026`	Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0255500`	Involved in abscisic acid (ABA) signaling during seed germination and abiotic stress response.	Characterization and Functional Analysis of Pyrabactin Resistance-Like Abscisic Acid Receptor Family in Rice.2015 · DOI: 10.1186/s12284-015-0061-6 Modulation of ABA Signaling by Altering VxGΦL Motif of PP2Cs in Oryza sativa.2017 · DOI: 10.1016/j.molp.2017.08.003
`Os05g0213500`	Intracellular abscisic acid (ABA) receptor that functions as a positive regulator of ABA signaling pathway.	A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth.2012 · DOI: 10.1093/jxb/err338 Overexpression of PYL5 in rice enhances drought tolerance, inhibits growth, and modulates gene expression.2014 · DOI: 10.1093/jxb/ert397

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026354 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0090351 seedling development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G01360

ath:AT4G01026

ath:AT5G53160

dosa:Os02g0255500

dosa:Os05g0213500

osa:4328916

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.573

Rank 1 · TkA06G014220 · TK1151

Nucleus0.440

Rank 2 · TkA06G014220 · TK1151

Cell membrane0.149

Rank 3 · TkA06G014220 · TK1151

Lysosome / Vacuole0.059

Rank 4 · TkA06G014220 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA06G014220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10604Polyketide_cyc233-177 aa

PF03364Polyketide_cyc39-110 aa

PF13353Fer4_1262-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G014220	`PF10604`	Polyketide_cyc2	33	177	3.7e-19	70.1
TkA06G014220	`PF03364`	Polyketide_cyc	39	110	0.067	14.2
TkA06G014220	`PF13353`	Fer4_12	62	136	0.12	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGM1`	Arabidopsis thaliana	sp\|Q9FGM1\|PYL8_ARATH Abscisic acid receptor PYL8	79.200%	Swiss-Prot	High
`Q84MC7`	Arabidopsis thaliana	sp\|Q84MC7\|PYL9_ARATH Abscisic acid receptor PYL9	74.600%	Swiss-Prot	High
`Q1ECF1`	Arabidopsis thaliana	sp\|Q1ECF1\|PYL7_ARATH Abscisic acid receptor PYL7	74.900%	Swiss-Prot	High
`Q6EN42`	Oryza sativa subsp. japonica	sp\|Q6EN42\|PYL3_ORYSJ Abscisic acid receptor PYL3	74.000%	Swiss-Prot	High
`Q6I5C3`	Oryza sativa subsp. japonica	sp\|Q6I5C3\|PYL5_ORYSJ Abscisic acid receptor PYL5	75.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card