RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G013300
Reference: TK1151 Chr: Chr06 Coordinates: 3474273-3475369 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

566 bp · TkA06G013300|TK1151|cDNA

TTTCGGAATTTTTTAAGCACCTATATTTCGAATTCAATTTTTGAAGCATCTTGAAGATGAAGAACAACCGAAGCGGAGGGGGAAAAGTATCACCTAAATGGATTATAATTTTCAGCATCTTCAGTTTCGTACTTGGCATGTTTTTTACAAACAGGGTGTGGGCTCCAATAGAATCCGATGGAAGGATCATGAGGCGGAAAGAACAAGAGATGAAAATCGTCACCGATGATTATATAACAAACAAGGATAATGATTTAATG...

CDS

Download CDS FASTA

510 bp · TkA06G013300|TK1151|CDS

ATGAAGAACAACCGAAGCGGAGGGGGAAAAGTATCACCTAAATGGATTATAATTTTCAGCATCTTCAGTTTCGTACTTGGCATGTTTTTTACAAACAGGGTGTGGGCTCCAATAGAATCCGATGGAAGGATCATGAGGCGGAAAGAACAAGAGATGAAAATCGTCACCGATGATTATATAACAAACAAGGATAATGATTTAATGGGCGAAGTTCATAAAACCCAAGAAGCAATTCAGTCACTTGAAAACTCAATATCAGA...

Protein

Download Protein FASTA

170 aa · TkA06G013300|TK1151|PROTEIN

MKNNRSGGGKVSPKWIIIFSIFSFVLGMFFTNRVWAPIESDGRIMRRKEQEMKIVTDDYITNKDNDLMGEVHKTQEAIQSLENSISELRLELPHNQSSFEEVKDDNLHSNKTNEDKSGRRTKAFMVIGINTAFSSRRRRDSIRETWMPRGEKLLQLEKEKGIVVRFMIGH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G013300
TK1151 IDTkA06G013300
OH-1004 IDLXL04_011265
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.100
Protein coverage (%)TK1151 98.824 / OH-1004 98.844
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G013300
LocationChr06:3474273-3475369 (-)
DescriptionSimilar to B3GALT7: Beta-1,3-galactosyltransferase 7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g22015 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue. No verified direct reference in this release
At1g77810 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue.
Identification of a novel group of putative Arabidopsis thaliana beta-(1,3)-galactosyltransferases.2008 · DOI: 10.1007/s11103-008-9351-3
At1g05170 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue. No verified direct reference in this release
At1g33430 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue. No verified direct reference in this release
At4g26940 Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal glycosyl residue. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011265 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009101 glycoprotein biosynthetic process Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0010208 pollen wall assembly Biological Process
GO:0010407 non-classical arabinogalactan protein metabolic process Biological Process
GO:0010584 pollen exine formation Biological Process
GO:0030244 cellulose biosynthetic process Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0008378 galactosyltransferase activity Molecular Function
GO:0048531 beta-1,3-galactosyltransferase activity Molecular Function
KEGG gene cross-reference
ath:AT1G05170
ath:AT1G22015
ath:AT1G32930
ath:AT1G33430
ath:AT1G77810
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.784
Rank 1 · TkA06G013300 · TK1151
Endoplasmic reticulum0.094
Rank 2 · TkA06G013300 · TK1151
Cytoplasm0.061
Rank 3 · TkA06G013300 · TK1151
Cell membrane0.060
Rank 4 · TkA06G013300 · TK1151
Extracellular0.051
Rank 5 · TkA06G013300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13334DUF409412-97 aa
PF20570DUF677917-113 aa
PF30757CCDC12546-101 aa
PF30081MAL13P1_147_C52-71 aa
PF01762Galactosyl_T58-81 aa
PF15770DUF469958-94 aa
PF13339AATF-Che162-116 aa
PF30081MAL13P1_147_C74-111 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G013300PF13334DUF409412974e-2382.4
TkA06G013300PF20570DUF6779171130.1713.2
TkA06G013300PF30757CCDC125461010.01216.4
TkA06G013300PF30081MAL13P1_147_C52710.08513.7
TkA06G013300PF01762Galactosyl_T58810.003617.8
TkA06G013300PF15770DUF469958940.004717.0
TkA06G013300PF13339AATF-Che1621160.01916.2
TkA06G013300PF30081MAL13P1_147_C741110.08513.7
TkA06G013300PF15770DUF46991001450.004717.0
TkA06G013300PF30355zf_C2H2-Disco1061090.02415.4
TkA06G013300PF30355zf_C2H2-Disco1261410.02415.4
TkA06G013300PF01762Galactosyl_T1371700.003617.8
TkA06G013300PF20570DUF67791431430.1713.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LM60Arabidopsis thalianasp|Q9LM60|B3GT5_ARATH Probable beta-1,3-galactosyltransferase 547.200%Swiss-ProtMedium
Q6NQB7Arabidopsis thalianasp|Q6NQB7|B3GT7_ARATH Beta-1,3-galactosyltransferase 746.500%Swiss-ProtMedium
A8MRC7Arabidopsis thalianasp|A8MRC7|B3GT2_ARATH Probable beta-1,3-galactosyltransferase 240.300%Swiss-ProtMedium
Q9C809Arabidopsis thalianasp|Q9C809|B3GT8_ARATH Probable beta-1,3-galactosyltransferase 842.000%Swiss-ProtMedium
Q8LEJ9Arabidopsis thalianasp|Q8LEJ9|B3GT4_ARATH Probable beta-1,3-galactosyltransferase 438.100%Swiss-ProtMedium

JBrowse

View in Genome Browser