TkA06G010930 | RubberDandelionOmics

Gene overview

TkA06G010930

Reference: TK1151 Chr: Chr06 Coordinates: 2842199-2844686 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1686 bp · TkA06G010930|TK1151|cDNA

GGATCATGCTACTGAAATATATGGTATTCTTGTCAATATCCCCATTATCTATTTATTTATTTAGACACTTAATCCGATACAAAGTTCAACAAGAAATAATATAAAGAGCAATTTGGTCCATGACCCTGCCCTTGGGAGTGGGCTAAGCAGCTGACCGGAGGACTACCGATAACACTCTGTGGCGGCGAGTGTCCGAATTGATTAATTCCACCGATGGAAGATTTGAGTCTGAAAGAGCACAAGAAATATGCTGCTGATAT...

CDS

Download CDS FASTA

1002 bp · TkA06G010930|TK1151|CDS

ATGGAAGATTTGAGTCTGAAAGAGCACAAGAAATATGCTGCTGATATCGACTCCATAACCAAAGCACACACACGCATCAAACCATATATTCACAAAACTCCCGTCCTATCTTCTGAAACCCTAAACTCCATTGCTGGAAAAAGCTTATTCTTCAAGTGTGAATGCTTCCAAAAAGGTGGAGCATTTAAATTCAGAGGTGCATCAAACACTGTCTTTTCTCTCGATGATGAGCAAGCTGCCAAAGGTGTTGCAACTCACAG...

Protein

Download Protein FASTA

333 aa · TkA06G010930|TK1151|PROTEIN

MEDLSLKEHKKYAADIDSITKAHTRIKPYIHKTPVLSSETLNSIAGKSLFFKCECFQKGGAFKFRGASNTVFSLDDEQAAKGVATHSSGNHAAALALAAKMRGIPAYIVIPENAPKCKVENVKRYGGQVIWCEGTMKSREETAKKVLNETGAVLVHPYNDPRTISGQGTLSLEFLEQVPHLDTLIVPISGGGLISGVTIGAKSINPGIRVIAAEPKGADDAAQSKASGQIITLTQTNTIADGLRASLGDLTWPIVRDLVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G010930`
TK1151 ID	TkA06G010930
OH-1004 ID	LXL04_005070
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	33.700
Protein coverage (%)	TK1151 87.688 / OH-1004 45.611 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G010930

Location Chr06:2842199-2844686 (+)

Description Similar to TD1: Threonine dehydratase 1 biosynthetic, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11640`	Pyridoxal-5'-phosphate (PLP)-dependent enzyme that catalyzes the synthesis of D-serine from L-serine.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XWA9`	Pyridoxal-5'-phosphate (PLP)-dependent enzyme that catalyzes the synthesis of D-serine from L-serine.	No verified direct reference in this release
`Os04g0555900`	Pyridoxal-5'-phosphate (PLP)-dependent enzyme that catalyzes the synthesis of D-serine from L-serine.	Occurrence of D-serine in rice and characterization of rice serine racemase.2009 · DOI: 10.1016/j.phytochem.2009.01.003 Site-directed mutagenesis of rice serine racemase: evidence that Glu219 and Asp225 mediate the effects of Mg2+ on the activity.2010 · DOI: 10.1002/cbdv.200900257

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005070 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0006565 L-serine catabolic process Biological Process

GO:0006566 L-threonine metabolic process Biological Process

GO:0006567 L-threonine catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009097 isoleucine biosynthetic process Biological Process

GO:0009625 response to insect Biological Process

GO:0031349 positive regulation of defense response Biological Process

GO:0051289 protein homotetramerization Biological Process

GO:0080027 response to herbivore Biological Process

GO:0009507 chloroplast Cellular Component

GO:0003941 L-serine ammonia-lyase activity Molecular Function

KEGG gene cross-reference

ath:AT3G10050

bmj:BMULJ_02699

bmu:Bmul_0562

nau:109229701

sly:100037737

sly:543983

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · TkA06G010930 · TK1151

Mitochondrion0.298

Rank 2 · TkA06G010930 · TK1151

Nucleus0.194

Rank 3 · TkA06G010930 · TK1151

Peroxisome0.094

Rank 4 · TkA06G010930 · TK1151

Plastid0.053

Rank 5 · TkA06G010930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00291PALP27-319 aa

PF24306THSD1_N46-70 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G010930	`PF00291`	PALP	27	319	1.6e-79	268.1
TkA06G010930	`PF24306`	THSD1_N	46	70	0.059	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q2PGG3`	Arabidopsis thaliana	sp\|Q2PGG3\|SRR_ARATH Serine racemase	76.300%	Swiss-Prot	High
`A2XWA9`	Oryza sativa subsp. indica	sp\|A2XWA9\|SRR_ORYSI Serine racemase	73.500%	Swiss-Prot	High
`Q7XSN8`	Oryza sativa subsp. japonica	sp\|Q7XSN8\|SRR_ORYSJ Serine racemase	73.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card