TkA06G009990 | RubberDandelionOmics

Gene overview

TkA06G009990

Reference: TK1151 Chr: Chr06 Coordinates: 2561965-2563694 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1280 bp · TkA06G009990|TK1151|cDNA

TTGGGTCTTACTTTCCTTTTTAAAGTTTCGTTCTTTAATGTGAAAGACGAGTACGCGCTCAATCGCTCACCTCGACTCTATATATAGGTGTTAATTTATCCGAGTCTTCATCACAACTTGAAATTATTTCCTACAAAACCTTCATCTGACTGTGCTTTTCGTTGATAATCTGCGACAAATTTTCATCATACTTGAATCCTCTACTAAAAAAATTCAGGAATTTTCTTTTGTAATCCACAAAATCACCCAAATATGACTTG...

CDS

Download CDS FASTA

948 bp · TkA06G009990|TK1151|CDS

ATGACTTGGATTTCTATATTCACTGGCAAATCTGGATTTGCTGCTTCCTCCACAGCTGAAGATGTTACTAAAGGAGTTGATGGAAATGGCATCACCGCCATTGTTACCGGAGCTACAAGTGGTATCGGGTTAGAAACAACCCGGGTGCTTGCCTTACGTGGGGTACATGTGGTTATGCCCGTCAGAAACCTGGAAGCTGGTAAAAAAGTGAAAGAAGACATCACCGAGAAAATCCCAAATGCTAAACTTGATGTGATGGA...

Protein

Download Protein FASTA

315 aa · TkA06G009990|TK1151|PROTEIN

MTWISIFTGKSGFAASSTAEDVTKGVDGNGITAIVTGATSGIGLETTRVLALRGVHVVMPVRNLEAGKKVKEDITEKIPNAKLDVMELDISSQQSVRKFACEYCSKGLPLNILILNAGIMTPPFSLNKDNIELQFATNHIGNFLLTNLLMDTMKKTTKESGKEGRIVILTSKLHNMTYKEGIRFDKINDEKSYNALSAYGQSKLANALHAKELTRRFQEEGVNITANSVHPGVIATNLGRHSGFNSFFYSVFNFILKNIP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G009990`
TK1151 ID	TkA06G009990
OH-1004 ID	LXL04_026435
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.800
Protein coverage (%)	TK1151 99.365 / OH-1004 35.108 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G009990

Location Chr06:2561965-2563694 (+)

Description Similar to TIC32: Short-chain dehydrogenase TIC 32, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23430`	Involved in protein precursor import into chloroplasts.	Tic32, an essential component in chloroplast biogenesis.2004 · DOI: 10.1074/jbc.m402817200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026435 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0005516 calmodulin binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT4G23430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.287

Rank 1 · TkA06G009990 · TK1151

Cytoplasm0.274

Rank 2 · TkA06G009990 · TK1151

Mitochondrion0.243

Rank 3 · TkA06G009990 · TK1151

Peroxisome0.138

Rank 4 · TkA06G009990 · TK1151

Cell membrane0.084

Rank 5 · TkA06G009990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short32-179 aa

PF08659KR32-122 aa

PF01370Epimerase34-219 aa

PF13561adh_short_C237-263 aa

PF13460NAD_binding_1037-98 aa

PF00106adh_short191-240 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G009990	`PF00106`	adh_short	32	179	1.9e-28	100.0
TkA06G009990	`PF08659`	KR	32	122	2.8e-06	28.1
TkA06G009990	`PF01370`	Epimerase	34	219	0.0004	20.6
TkA06G009990	`PF13561`	adh_short_C2	37	263	5.1e-16	59.7
TkA06G009990	`PF13460`	NAD_binding_10	37	98	0.17	12.5
TkA06G009990	`PF00106`	adh_short	191	240	1.9e-28	100.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A2RVM0`	Arabidopsis thaliana	sp\|A2RVM0\|TIC32_ARATH Short-chain dehydrogenase TIC 32, chloroplastic	66.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card