TkA06G009740 | RubberDandelionOmics

Gene overview

TkA06G009740

Reference: TK1151 Chr: Chr06 Coordinates: 2508633-2511235 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1661 bp · TkA06G009740|TK1151|cDNA

TTACGGAAACCTTACGAAAAGAAAAACATATTTTCCTTCACATATGCGGACATTCAAAGTTTAAACACATTATTTGGTCATCCTCTTCGCAAGTGAATCAGTTGGCTCTCAAATTCTAGAATGGCCACACCTAATCAAGAATCAATCGAGACGTTCATGAGTATCACCGGTTCATCTGCAGTGGTTGCGCTTCAGAAACTGACGGAACATGGTGGTAATCTCAATGAAGCGGTTAATGTACATTTTACAGAAGGAGATAC...

CDS

Download CDS FASTA

1371 bp · TkA06G009740|TK1151|CDS

ATGGCCACACCTAATCAAGAATCAATCGAGACGTTCATGAGTATCACCGGTTCATCTGCAGTGGTTGCGCTTCAGAAACTGACGGAACATGGTGGTAATCTCAATGAAGCGGTTAATGTACATTTTACAGAAGGAGATACAAACATACATCAAACAGATGTTGCTCCTCCACAAGAGGACTTCATGGACATAGATGAGCCAAGTGAAACCACAAATCACATACCACCATTCTCACCTTTTCCTGAAAGTGCTCCCAGAAT...

Protein

Download Protein FASTA

456 aa · TkA06G009740|TK1151|PROTEIN

MATPNQESIETFMSITGSSAVVALQKLTEHGGNLNEAVNVHFTEGDTNIHQTDVAPPQEDFMDIDEPSETTNHIPPFSPFPESAPRIENLTQTLPENHGTLSINDDNDFPSLPSGLSGHNEGLISHSSHETRLTPSAPDLPDHGIEEEMIRAAIEASKNDAILQQVQLDDPSISHAVSLSLESAEQDKARSSIVSVIEQVGTSASASANGRLRSEDTDEQPLVRHRSRSRHMGEEKDSSLTLGPTPTHHQTINNDFPSDT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G009740`
TK1151 ID	TkA06G009740
OH-1004 ID	LXL04_026481
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G009740

Location Chr06:2508633-2511235 (-)

Description Similar to PUX8: Plant UBX domain-containing protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11740`	Plant UBX domain-containing protein 8.	No verified direct reference in this release
`At4g23040`	Plant UBX domain-containing protein 13.	No verified direct reference in this release
`At4g00752`	Plant UBX domain-containing protein 9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026481 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0036337 Fas signaling pathway Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0042176 regulation of protein catabolic process Biological Process

GO:0043124 negative regulation of canonical NF-kappaB signal transduction Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045732 positive regulation of protein catabolic process Biological Process

GO:0045740 positive regulation of DNA replication Biological Process

GO:1905691 lipid droplet disassembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

KEGG gene cross-reference

ath:AT4G00752

ath:AT4G10790

ath:AT4G11740

ath:AT4G23040

hsa:11124

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.700

Rank 1 · TkA06G009740 · TK1151

Nucleus0.363

Rank 2 · TkA06G009740 · TK1151

Golgi apparatus0.084

Rank 3 · TkA06G009740 · TK1151

Endoplasmic reticulum0.076

Rank 4 · TkA06G009740 · TK1151

Cell membrane0.067

Rank 5 · TkA06G009740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22566UBA_85-45 aa

PF14555UBA_46-46 aa

PF07768PVL_ORF50303-371 aa

PF00789UBX375-454 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G009740	`PF22566`	UBA_8	5	45	3.6e-05	24.2
TkA06G009740	`PF14555`	UBA_4	6	46	1.5e-10	41.4
TkA06G009740	`PF07768`	PVL_ORF50	303	371	1.4	10.0
TkA06G009740	`PF00789`	UBX	375	454	1.6e-19	70.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JPR7`	Arabidopsis thaliana	sp\|F4JPR7\|PUX8_ARATH Plant UBX domain-containing protein 8	42.500%	Swiss-Prot	Medium
`Q9C5G7`	Arabidopsis thaliana	sp\|Q9C5G7\|PUX13_ARATH Plant UBX domain-containing protein 13	40.600%	Swiss-Prot	Medium
`Q4V3D3`	Arabidopsis thaliana	sp\|Q4V3D3\|PUX9_ARATH Plant UBX domain-containing protein 9	30.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card