TkA06G006440 | RubberDandelionOmics

Gene overview

TkA06G006440

Reference: TK1151 Chr: Chr06 Coordinates: 1627296-1628377 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

882 bp · TkA06G006440|TK1151|cDNA

ATGGCTGCCGCCTTCTGTTCTTCTGCTTCTTCCTCCTCCATTTCTGCATCCTCTCTCCTCATCCTCATCCGCCTTTCACCCCTAGAAGGAAAAGAAGACGATGAGTCTTGCGAGCAAAACAGTGTAAAAGCTACCCCAAGTGATTGCTCCGAAAACAGCAAAGAACCGTATTACGTCCATCAACCAACACCGCTCCACCTGCAAAACTCCAAGACCACTGCCAAATCGTCGAAAAAGAGATCGGAATCATGCGACCGGGG...

CDS

Download CDS FASTA

882 bp · TkA06G006440|TK1151|CDS

ATGGCTGCCGCCTTCTGTTCTTCTGCTTCTTCCTCCTCCATTTCTGCATCCTCTCTCCTCATCCTCATCCGCCTTTCACCCCTAGAAGGAAAAGAAGACGATGAGTCTTGCGAGCAAAACAGTGTAAAAGCTACCCCAAGTGATTGCTCCGAAAACAGCAAAGAACCGTATTACGTCCATCAACCAACACCGCTCCACCTGCAAAACTCCAAGACCACTGCCAAATCGTCGAAAAAGAGATCGGAATCATGCGACCGGGG...

Protein

Download Protein FASTA

293 aa · TkA06G006440|TK1151|PROTEIN

MAAAFCSSASSSSISASSLLILIRLSPLEGKEDDESCEQNSVKATPSDCSENSKEPYYVHQPTPLHLQNSKTTAKSSKKRSESCDRGKKSDDRGISCNKCRPSAREKFSVVPLDTTTAGRHSNASPNGLFKSIFSSIVKKSPRSASSSSEGFTPVAGNEEQWKGAVAELSHKLIQATKKRDEAILEASRLKFSMVELEKKLNKLEIYCHTLKSGLDDCTNKSTTTKHEPIKIGDHDRVIEQFLVACVRISIIYETSEPFI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G006440`
TK1151 ID	TkA06G006440
OH-1004 ID	LXL04_026537
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.400
Protein coverage (%)	TK1151 83.618 / OH-1004 50.913 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G006440`
Location	Chr06:1627296-1628377 (+)
Description	Similar to IRKI: IRK-interacting protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026537` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009639 response to red or far red light Biological Process GO:0009959 negative gravitropism Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT5G12900 ath:AT5G58960 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.452

Rank 1 · TkA06G006440 · TK1151

Nucleus0.352

Rank 2 · TkA06G006440 · TK1151

Cell membrane0.272

Rank 3 · TkA06G006440 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA06G006440 · TK1151

Mitochondrion0.046

Rank 5 · TkA06G006440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04356DUF489155-224 aa

PF27605ODF2_C159-216 aa

PF28968PMD1-like165-218 aa

PF27572TRA2_N173-252 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G006440	`PF04356`	DUF489	155	224	0.04	14.7
TkA06G006440	`PF27605`	ODF2_C	159	216	0.024	14.5
TkA06G006440	`PF28968`	PMD1-like	165	218	0.002	18.4
TkA06G006440	`PF27572`	TRA2_N	173	252	0.2	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card