TkA06G001020 | RubberDandelionOmics

Gene overview

TkA06G001020

Reference: TK1151 Chr: Chr06 Coordinates: 224505-229157 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3660 bp · TkA06G001020|TK1151|cDNA

CAACAATCTCTTAACACCCCCTCATTGTCTTTTCTTTCATCTCATATATTTCACTTTTAACTTCGGTAGGCCTGTCCCTAACCCACCATTCTATTTTTATTCATAAATTCATCTCTCCTTATCTCTTTCCCATAACCCGTGTCTTGAAATTGCTCCTTCTCTTCCATCCCCATACAAATTCATCGACTTTCTTCAATAAAGTCATGTTTTGATCCTCAAATCGACATCCTTTAATGCCCAAAAGTGATTTTCTCTTCTTC...

CDS

Download CDS FASTA

2967 bp · TkA06G001020|TK1151|CDS

ATGTCAAAGCAGCCCATTCTACCTTCTTCCCGCCAAATTACATATGTATTCTTCTTATTATTTTCCTTCGCCGGCATATTTTTCCGGTCAGTATTCTGCTCTTCCTCGTCTGTTGAAGTCCACGCACTGATTGATTTCAAGAAACAGCTAAAAGACCCTTTGAATTACTTGGATTCATGGAAGATCACGGAATCCCCTTGTCAATTTTACGGGGTTTCTTGCGACGATCAAACGGGTCGGGTGGTGGGGATTTCGTTGAA...

Protein

Download Protein FASTA

988 aa · TkA06G001020|TK1151|PROTEIN

MSKQPILPSSRQITYVFFLLFSFAGIFFRSVFCSSSSVEVHALIDFKKQLKDPLNYLDSWKITESPCQFYGVSCDDQTGRVVGISLNYKSLSGKISPALGALQSLKSLVIPSNYIYGELPTALVNCSDLRVLNVTANNITGVLPDLSKLQKLEILDVSNNYLTGDFPTWVGSLTRLSKLGLNDNNFEEGGIPENIGNLTNLRWLNLGGISLTGEIPKSVFDLKDLETLDLSSNKISGDFPVEITKLRNLLKIELFGNRLT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G001020`
TK1151 ID	TkA06G001020
OH-1004 ID	LXL04_026602
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G001020

Location Chr06:224505-229157 (+)

Description Similar to CEPR2: Receptor protein-tyrosine kinase CEPR2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72180`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	No verified direct reference in this release
`At5g49660`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6 CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231
`At1g09970`	Plays a role in pattern-triggered immunity (PTI) signaling induced by pathogen-associated molecular patterns (PAMPs).	RLK7, a leucine-rich repeat receptor-like kinase, is required for proper germination speed and tolerance to oxidative stress in Arabidopsis thaliana.2010 · DOI: 10.1007/s00425-010-1260-4 The secreted peptide PIP1 amplifies immunity through receptor-like kinase 7.2014 · DOI: 10.1371/journal.ppat.1004331
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
`At1g28440`	Receptor-like protein kinase HSL1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026602 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009845 seed germination Biological Process

GO:0009960 endosperm development Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010555 response to mannitol Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048437 floral organ development Biological Process

KEGG gene cross-reference

ath:AT1G09970

ath:AT1G28440

ath:AT1G72180

ath:AT3G19700

ath:AT5G49660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.855

Rank 1 · TkA06G001020 · TK1151

Endoplasmic reticulum0.094

Rank 2 · TkA06G001020 · TK1151

Cytoplasm0.059

Rank 3 · TkA06G001020 · TK1151

Lysosome / Vacuole0.034

Rank 4 · TkA06G001020 · TK1151

Nucleus0.034

Rank 5 · TkA06G001020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17561TssO13-42 aa

PF08263LRRNT_239-75 aa

PF00560LRR_185-102 aa

PF12799LRR_485-113 aa

PF25019LRR_R13L1-DRL2195-110 aa

PF24758LRR_At5g5637097-158 aa

PF23598LRR_1498-181 aa

PF23952LRR_EndoS101-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G001020	`PF17561`	TssO	13	42	0.037	14.7
TkA06G001020	`PF08263`	LRRNT_2	39	75	1.1e-09	39.1
TkA06G001020	`PF00560`	LRR_1	85	102	3.8e-43	136.8
TkA06G001020	`PF12799`	LRR_4	85	113	2.8e-27	94.8
TkA06G001020	`PF25019`	LRR_R13L1-DRL21	95	110	2.1e-06	28.4
TkA06G001020	`PF24758`	LRR_At5g56370	97	158	1.8e-06	28.5
TkA06G001020	`PF23598`	LRR_14	98	181	2.3e-32	112.8
TkA06G001020	`PF23952`	LRR_EndoS	101	160	0.11	13.4
TkA06G001020	`PF12799`	LRR_4	103	140	2.8e-27	94.8
TkA06G001020	`PF24141`	LRR_ComC	103	192	2.7e-06	28.0
TkA06G001020	`PF00560`	LRR_1	104	126	3.8e-43	136.8
TkA06G001020	`PF13855`	LRR_8	104	146	3.4e-34	117.1
TkA06G001020	`PF29594`	LRR_SKP2	119	135	0.00014	21.9
TkA06G001020	`PF13516`	LRR_6	126	141	0.0052	17.4
TkA06G001020	`PF00560`	LRR_1	129	145	3.8e-43	136.8
TkA06G001020	`PF13855`	LRR_8	129	186	3.4e-34	117.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7T7`	Arabidopsis thaliana	sp\|Q9C7T7\|CEPR2_ARATH Receptor protein-tyrosine kinase CEPR2	51.200%	Swiss-Prot	Low
`Q9FGL5`	Arabidopsis thaliana	sp\|Q9FGL5\|CEPR1_ARATH Receptor protein-tyrosine kinase CEPR1	40.000%	Swiss-Prot	Low
`F4I2N7`	Arabidopsis thaliana	sp\|F4I2N7\|RLK7_ARATH Receptor-like protein kinase 7	42.100%	Swiss-Prot	Low
`Q9M0G7`	Arabidopsis thaliana	sp\|Q9M0G7\|MIK1_ARATH MDIS1-interacting receptor like kinase 1	45.200%	Swiss-Prot	Low
`Q9SGP2`	Arabidopsis thaliana	sp\|Q9SGP2\|HSL1_ARATH Receptor-like protein kinase HSL1	39.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card