TkA05G474220 | RubberDandelionOmics

Gene overview

TkA05G474220

Reference: TK1151 Chr: Chr05 Coordinates: 119036311-119036913 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

603 bp · TkA05G474220|TK1151|cDNA

ATGTTAAATCTGAATCAACCTACAATTGCAAGTGGAACAGCAAACGAGGAAGTGTACAAGATACTGATTTATGACAAGTTTTGTCAAGACATCCTGTCCCCGCTCATCCATGTGAAGGATCTCCGCAAGCATGGTGTGACACTGTACGTCCTTATCGATAAAAACCACAAGCCTATTGTGGATGTTCCTGCTGTTTACTTCGTAAAACCTTGTCAGCACAACATTCAAAGAATCATTTCGGATGCCTCTAATTCTCTCTA...

CDS

Download CDS FASTA

603 bp · TkA05G474220|TK1151|CDS

ATGTTAAATCTGAATCAACCTACAATTGCAAGTGGAACAGCAAACGAGGAAGTGTACAAGATACTGATTTATGACAAGTTTTGTCAAGACATCCTGTCCCCGCTCATCCATGTGAAGGATCTCCGCAAGCATGGTGTGACACTGTACGTCCTTATCGATAAAAACCACAAGCCTATTGTGGATGTTCCTGCTGTTTACTTCGTAAAACCTTGTCAGCACAACATTCAAAGAATCATTTCGGATGCCTCTAATTCTCTCTA...

Protein

Download Protein FASTA

200 aa · TkA05G474220|TK1151|PROTEIN

MLNLNQPTIASGTANEEVYKILIYDKFCQDILSPLIHVKDLRKHGVTLYVLIDKNHKPIVDVPAVYFVKPCQHNIQRIISDASNSLYDYFHLNFSWSIPRPLLEDVATGTLNSDSIQRVSNVHDQYLEFVTLEDNLFSIADKSCYVRLNDPKATDREIEEIIEKLVSGLLCVLATLAVVLIIRYPRGDGCIIAGPVIICL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G474220`
TK1151 ID	TkA05G474220
OH-1004 ID	LXL04_022522
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.000 / OH-1004 46.875 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G474220

Location Chr05:119036311-119036913 (-)

Description Similar to SLY1: SEC1 family transport protein SLY1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17980`	May be involved in the early secretory pathway.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0620800`	May be involved in the early secretory pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022522 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0051223 regulation of protein transport Biological Process

GO:0060628 regulation of ER to Golgi vesicle-mediated transport Biological Process

GO:1902902 negative regulation of autophagosome assembly Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT2G17980

dosa:Os03g0620800

hsa:23256

mmu:76983

rno:54350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.669

Rank 1 · TkA05G474220 · TK1151

Nucleus0.244

Rank 2 · TkA05G474220 · TK1151

Cell membrane0.130

Rank 3 · TkA05G474220 · TK1151

Golgi apparatus0.126

Rank 4 · TkA05G474220 · TK1151

Lysosome / Vacuole0.121

Rank 5 · TkA05G474220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00995Sec120-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G474220	`PF00995`	Sec1	20	187	1.5e-40	140.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SL48`	Arabidopsis thaliana	sp\|Q9SL48\|SLY1_ARATH SEC1 family transport protein SLY1	71.100%	Swiss-Prot	High
`Q851W1`	Oryza sativa subsp. japonica	sp\|Q851W1\|SLY1_ORYSJ SEC1 family transport protein SLY1	45.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card