TkA05G473040 | RubberDandelionOmics

Gene overview

TkA05G473040

Reference: TK1151 Chr: Chr05 Coordinates: 118724057-118726801 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

866 bp · TkA05G473040|TK1151|cDNA

TGTTGCTTTCTAAAAAACGATGTTTAAATTGGACCTCTATGTTTATCTAATACTTTTGTTTTGACATGACACAGCATGGAGAGTATCTTGGAGCGATATGAGCGGTACTCTTATACTGAGAGACAGCTAGTTACAGCTGATGCTGCACCGAGAAGCTGGACACTGGAGTACAACAAACTGAAATCTAGGGCTGAGCTCTTACAAAGAAATCACAGGCACTATATGGGTGAAGATATAGAGTCGTTGAGCTTGAAAGAAAT...

CDS

Download CDS FASTA

564 bp · TkA05G473040|TK1151|CDS

ATGGAGAGTATCTTGGAGCGATATGAGCGGTACTCTTATACTGAGAGACAGCTAGTTACAGCTGATGCTGCACCGAGAAGCTGGACACTGGAGTACAACAAACTGAAATCTAGGGCTGAGCTCTTACAAAGAAATCACAGGCACTATATGGGTGAAGATATAGAGTCGTTGAGCTTGAAAGAAATTCAAAATTTGGAGCAACAGCTTGATACTGGTCTCAAGAACATTCGCACAAGAAAAAATCAACTCCTGCATGAATC...

Protein

Download Protein FASTA

187 aa · TkA05G473040|TK1151|PROTEIN

MESILERYERYSYTERQLVTADAAPRSWTLEYNKLKSRAELLQRNHRHYMGEDIESLSLKEIQNLEQQLDTGLKNIRTRKNQLLHESISELQKKGKAIQEQNTTLTKKIKEKEKEKTVPQNTHDWEHHNYIDTDPTFLMPPPPPSLHMGGNYNQGGGGDGEAAEGRTNELDLSLQPIYSCHMRCFPS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G473040`
TK1151 ID	TkA05G473040
OH-1004 ID	LXL04_030569
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	52.800
Protein coverage (%)	TK1151 85.027 / OH-1004 64.783 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G473040`
Location	Chr05:118724057-118726801 (+)
Description	Similar to AP1: Agamous-like MADS-box protein AP1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030569` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009908 flower development Biological Process GO:0009911 positive regulation of flower development Biological Process GO:0010077 maintenance of inflorescence meristem identity Biological Process GO:0010154 fruit development Biological Process GO:0010582 floral meristem determinacy Biological Process GO:0030154 cell differentiation Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0060560 developmental growth involved in morphogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function
KEGG gene cross-reference	ath:AT5G60910 sot:102577795 vvi:100232952 vvi:100232953 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.938

Rank 1 · TkA05G473040 · TK1151

Cytoplasm0.142

Rank 2 · TkA05G473040 · TK1151

Cell membrane0.034

Rank 3 · TkA05G473040 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA05G473040 · TK1151

Plastid0.011

Rank 5 · TkA05G473040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09674DUF240018-113 aa

PF01486K-box26-110 aa

PF24617POF1B_HlH32-68 aa

PF00170bZIP_133-68 aa

PF03321GH336-133 aa

PF29231DUF851738-102 aa

PF07217Het-C50-135 aa

PF23204KIF21A_2nd51-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G473040	`PF09674`	DUF2400	18	113	0.12	13.1
TkA05G473040	`PF01486`	K-box	26	110	1.4e-29	102.8
TkA05G473040	`PF24617`	POF1B_HlH	32	68	3.5	8.8
TkA05G473040	`PF00170`	bZIP_1	33	68	6.4	7.7
TkA05G473040	`PF03321`	GH3	36	133	0.014	15.3
TkA05G473040	`PF29231`	DUF8517	38	102	0.028	15.1
TkA05G473040	`PF07217`	Het-C	50	135	0.22	10.7
TkA05G473040	`PF23204`	KIF21A_2nd	51	64	0.31	12.0
TkA05G473040	`PF24617`	POF1B_HlH	78	124	3.5	8.8
TkA05G473040	`PF23204`	KIF21A_2nd	80	122	0.31	12.0
TkA05G473040	`PF00170`	bZIP_1	85	115	6.4	7.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card