TkA05G468730 | RubberDandelionOmics

Gene overview

TkA05G468730

Reference: TK1151 Chr: Chr05 Coordinates: 117414440-117416882 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1366 bp · TkA05G468730|TK1151|cDNA

GGATAAAAGCTACATAACGAAACGAAGAAATAGCGGAGACTTTAACTTGACTTCATTGCTAATTTATTATCCTTGATTCCTCTGTTTTTGTTCAAAACCCCGCCCCTTTTCATTTTGCCTTTAATGTACGGACAAACTTTAGAAAAGCAATCGTCGAATTTTGATTGTTGACACTGCTACTGGATCTCCACCCACGATCACTTCCTTAGCCAGCAAGCGAATACACGTCCTTTTCTGAACGATACAACAAGAACAACAAA...

CDS

Download CDS FASTA

975 bp · TkA05G468730|TK1151|CDS

ATGGTCTCTCGACGACATAGTCAACGACGGCCTTTACGAACACCAGAGGAAACACGTACTGAATTAGCTTCCACCATGAAGATGATGTACAGAGCACCATTCGCAGAAATTTCTTCTTTAAGAAAGGCGAAAGGTAAAGAGAAAATGATGTATGATGTTACTGTTGGTGATTGGAGAAACAGTGAACGCCGAAAAGAGCCTTACAGAACTTTACCTGGTGATCTGCTTATTTTAGCAAATGGGGAACCCGGTTCTGTTTC...

Protein

Download Protein FASTA

325 aa · TkA05G468730|TK1151|PROTEIN

MVSRRHSQRRPLRTPEETRTELASTMKMMYRAPFAEISSLRKAKGKEKMMYDVTVGDWRNSERRKEPYRTLPGDLLILANGEPGSVSDLQSNKWAFLLVNNTEDDDGTPVQFKVTASQEIEIHDGMFVVFLMNITTQKRIWNSLHKHANLDIIKEILYPDSMVNEKCDECSLGCNNHIQRFDPSLVSKLNESQKAAIMAAICKMECSHKSSVEQIWGPPGTGKTMTVSVMLSIFLQMKCRTLTCAPTNVAIVAVASRVLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G468730`
TK1151 ID	TkA05G468730
OH-1004 ID	LXL04_022441
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 95.385 / OH-1004 10.161 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G468730`
Location	Chr05:117414440-117416882 (-)
Description	Similar to TRANK1: TPR and ankyrin repeat-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022441` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006283 transcription-coupled nucleotide-excision repair Biological Process GO:0006353 DNA-templated transcription termination Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006364 rRNA processing Biological Process GO:0006369 termination of RNA polymerase II transcription Biological Process GO:0006386 termination of RNA polymerase III transcription Biological Process GO:0006399 tRNA metabolic process Biological Process GO:0006974 DNA damage response Biological Process GO:0008033 tRNA processing Biological Process GO:0009553 embryo sac development Biological Process GO:0009875 pollen-pistil interaction Biological Process GO:0010183 pollen tube guidance Biological Process
KEGG gene cross-reference	ath:AT4G15570 hsa:9881 mmu:320429 sce:YLR430W spo:2540523 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.513

Rank 1 · TkA05G468730 · TK1151

Cytoplasm0.395

Rank 2 · TkA05G468730 · TK1151

Cell membrane0.089

Rank 3 · TkA05G468730 · TK1151

Endoplasmic reticulum0.068

Rank 4 · TkA05G468730 · TK1151

Extracellular0.053

Rank 5 · TkA05G468730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01078Mg_chelatase6-23 aa

PF20073DUF646916-163 aa

PF13086AAA_11188-312 aa

PF04851ResIII188-248 aa

PF13604AAA_30189-254 aa

PF13245AAA_19209-270 aa

PF13752DUF4165210-278 aa

PF13191AAA_16214-243 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G468730	`PF01078`	Mg_chelatase	6	23	0.1	12.7
TkA05G468730	`PF20073`	DUF6469	16	163	5.1e-47	160.8
TkA05G468730	`PF13086`	AAA_11	188	312	7.3e-14	52.9
TkA05G468730	`PF04851`	ResIII	188	248	0.013	16.2
TkA05G468730	`PF13604`	AAA_30	189	254	0.00058	20.4
TkA05G468730	`PF13245`	AAA_19	209	270	6.3e-06	27.1
TkA05G468730	`PF13752`	DUF4165	210	278	0.11	13.3
TkA05G468730	`PF13191`	AAA_16	214	243	0.19	12.9
TkA05G468730	`PF00004`	AAA	215	238	0.0078	17.4
TkA05G468730	`PF01078`	Mg_chelatase	215	241	0.1	12.7
TkA05G468730	`PF13401`	AAA_22	215	239	0.25	12.4
TkA05G468730	`PF03831`	YjdM	263	312	0.0027	18.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card