RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G465590
Reference: TK1151 Chr: Chr05 Coordinates: 116715504-116720390 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2280 bp · TkA05G465590|TK1151|cDNA

ATGCCCATGTTACTTGAGTGGGCAATTGGAAACTTGCCTTGTGAAATAGCAATTAAATATGCAAATACTTTCCAATGCAATGGAAAGAGCGAATGCAATCAAAATTATACAGGTCCTGGGTATCGTTGTCTTTGCCTTGCAGGTTCATCAGCTGCTGCCATATTTTTTATTGTGTTTGTCAACTGGTTGTATTTCGGACTCAAGAAACGTAAGCATATGATGCTTAGAGAAAAATTCTTTCAACAAAATGGTGGAATAAT...

CDS

Download CDS FASTA

2280 bp · TkA05G465590|TK1151|CDS

ATGCCCATGTTACTTGAGTGGGCAATTGGAAACTTGCCTTGTGAAATAGCAATTAAATATGCAAATACTTTCCAATGCAATGGAAAGAGCGAATGCAATCAAAATTATACAGGTCCTGGGTATCGTTGTCTTTGCCTTGCAGGTTCATCAGCTGCTGCCATATTTTTTATTGTGTTTGTCAACTGGTTGTATTTCGGACTCAAGAAACGTAAGCATATGATGCTTAGAGAAAAATTCTTTCAACAAAATGGTGGAATAAT...

Protein

Download Protein FASTA

759 aa · TkA05G465590|TK1151|PROTEIN

MPMLLEWAIGNLPCEIAIKYANTFQCNGKSECNQNYTGPGYRCLCLAGSSAAAIFFIVFVNWLYFGLKKRKHMMLREKFFQQNGGIMLQQRMSRDKGFQNQAKVFTIDELKKATNNYDESRIIGKGGYGTVYKGVLSDKSTVAIKKSKIADQNQTQIEQFINEVIIPSQINHRNVVKLIGCFLESEVPSLVYEFIPNGTVSDHLHNKSKSFGVVLVELLTRKNVLNFERPKGERNQANHFLSSLKEGRVFQVLDEQLQQH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G465590
TK1151 IDTkA05G465590
OH-1004 IDLXL04_022420
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)64.900
Protein coverage (%)TK1151 46.904 / OH-1004 35.750
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G465590
LocationChr05:116715504-116720390 (-)
DescriptionSimilar to WAK2: Wall-associated receptor kinase 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g21230 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21250 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Oxygen-evolving enhancer protein 2 is phosphorylated by glycine-rich protein 3/wall-associated kinase 1 in Arabidopsis.2003 · DOI: 10.1016/s0006-291x(03)00851-9
Aluminum-induced gene expression and protein localization of a cell wall-associated receptor kinase in Arabidopsis.2003 · DOI: 10.1104/pp.103.022129
At1g21240 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g16260 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g21210 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.
Antisense expression of a cell wall-associated protein kinase, WAK4, inhibits cell elongation and alters morphology.2001 · DOI: 10.1105/tpc.13.6.1317

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022420 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007166 cell surface receptor signaling pathway Biological Process
GO:0009311 oligosaccharide metabolic process Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009992 intracellular water homeostasis Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005509 calcium ion binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0030247 polysaccharide binding Molecular Function
KEGG gene cross-reference
ath:AT1G21230
ath:AT1G21270
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.610
Rank 1 · TkA05G465590 · TK1151
Cytoplasm0.209
Rank 2 · TkA05G465590 · TK1151
Nucleus0.146
Rank 3 · TkA05G465590 · TK1151
Endoplasmic reticulum0.094
Rank 4 · TkA05G465590 · TK1151
Golgi apparatus0.039
Rank 5 · TkA05G465590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23875DUF722950-114 aa
PF14536DUF444178-170 aa
PF00069Pkinase117-207 aa
PF07714PK_Tyr_Ser-Thr121-209 aa
PF25239WHD_CHMP7202-234 aa
PF00069Pkinase210-290 aa
PF07714PK_Tyr_Ser-Thr210-294 aa
PF25239WHD_CHMP7250-283 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G465590PF23875DUF7229501140.1313.1
TkA05G465590PF14536DUF4441781700.1213.2
TkA05G465590PF00069Pkinase1172076.4e-1969.1
TkA05G465590PF07714PK_Tyr_Ser-Thr1212091.4e-1867.8
TkA05G465590PF25239WHD_CHMP72022340.1113.5
TkA05G465590PF00069Pkinase2102906.4e-1969.1
TkA05G465590PF07714PK_Tyr_Ser-Thr2102941.4e-1867.8
TkA05G465590PF25239WHD_CHMP72502830.1113.5
TkA05G465590PF08541ACP_syn_III_C3594010.1313.1
TkA05G465590PF13961DUF42194124372e-0834.5
TkA05G465590PF14223Retrotran_gag_24285861.7e-1867.7
TkA05G465590PF08541ACP_syn_III_C5926090.1313.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LMN7Arabidopsis thalianasp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 534.000%Swiss-ProtLow
Q39191Arabidopsis thalianasp|Q39191|WAK1_ARATH Wall-associated receptor kinase 162.600%Swiss-ProtLow
Q9LMN8Arabidopsis thalianasp|Q9LMN8|WAK3_ARATH Wall-associated receptor kinase 340.600%Swiss-ProtLow
Q9SA25Arabidopsis thalianasp|Q9SA25|WAKLG_ARATH Wall-associated receptor kinase-like 848.900%Swiss-ProtLow
Q9LMN6Arabidopsis thalianasp|Q9LMN6|WAK4_ARATH Wall-associated receptor kinase 445.600%Swiss-ProtLow

JBrowse

View in Genome Browser