RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G465100
Reference: TK1151 Chr: Chr05 Coordinates: 116566445-116568842 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1636 bp · TkA05G465100|TK1151|cDNA

TTTTCTTATTTATCGATTTTCATTGTCCAAGAATTAAATATTTGGACATAACGCTAGAGTTGGCACATTCCCTCCTCTTGGTCTGTTTAATGTTTTCCCCCCTTTTGAATCTCCACAAATATTTAGAGCCAACGTTCACCCACACCACATCCATTCAGCAAAACCACAGGCTAGGGTTCTTGTTCTTCTCACAGTGTTGGATGTTATTCTCATTGTTCGATTGTGAATCTGTAGAATATCTGCGCAGAGGGATGGGCTGT...

CDS

Download CDS FASTA

1260 bp · TkA05G465100|TK1151|CDS

ATGTTTTCCCCCCTTTTGAATCTCCACAAATATTTAGAGCCAACGTTCACCCACACCACATCCATTCAGCAAAACCACAGGCTAGGGTTCTTGTTCTTCTCACAGTGTTGGATGTTATTCTCATTGTTCGATTGTGAATCTGTAGAATATCTGCGCAGAGGGATGGGCTGTCTCTTCAGCTGTTTCCGTGTTAGAGATGATCCTCGCCCTCAGATTAATCCTGTTCCACAACCGATCACTCACATGGAACCGCTCGATTC...

Protein

Download Protein FASTA

419 aa · TkA05G465100|TK1151|PROTEIN

MFSPLLNLHKYLEPTFTHTTSIQQNHRLGFLFFSQCWMLFSLFDCESVEYLRRGMGCLFSCFRVRDDPRPQINPVPQPITHMEPLDSLASNSLWSVLAPEAEDSDHSHDKDGRSGATGSPGSDDGLMAEAKFLKACGTLPQTPDELRTTKKLTDSQPQSGNMEATFNSWLPNTATEKALEKQHDQLHPPIKLFEESDNDSDSPPHSPNSLITGKSTDTSSSDDCVVIDPVKDTQTYTPMVASTQFKNKSVHFECESDTSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G465100
TK1151 IDTkA05G465100
OH-1004 IDLXL04_022407
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.900
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G465100
LocationChr05:116566445-116568842 (-)
DescriptionSimilar to JASON: Protein JASON
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g06660 Required for normal spindle orientation at male meiosis II and normal formation of tetrad of microspores.
The Arabidopsis mutant jason produces unreduced first division restitution male gametes through a parallel/fused spindle mechanism in meiosis II.2011 · DOI: 10.1104/pp.110.170415

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_022407 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0007142 male meiosis II Biological Process
GO:0009556 microsporogenesis Biological Process
GO:0051295 establishment of meiotic spindle localization Biological Process
GO:0005634 nucleus Cellular Component
GO:0005794 Golgi apparatus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009705 plant-type vacuole membrane Cellular Component
GO:0012505 endomembrane system Cellular Component
KEGG gene cross-reference
ath:AT1G06660
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.401
Rank 1 · TkA05G465100 · TK1151
Nucleus0.309
Rank 2 · TkA05G465100 · TK1151
Cell membrane0.308
Rank 3 · TkA05G465100 · TK1151
Endoplasmic reticulum0.092
Rank 4 · TkA05G465100 · TK1151
Golgi apparatus0.088
Rank 5 · TkA05G465100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4IDQ5Arabidopsis thalianasp|F4IDQ5|JASON_ARATH Protein JASON32.300%Swiss-ProtMedium

JBrowse

View in Genome Browser