Gene Card
Gene overview
cDNA / CDS / Protein Sequences
423 bp · TkA05G464140|TK1151|cDNA
CCTTCATTGAGGAGTAAAATGATGCGGTCTGCTTCCTCCATTGATGGAAAGTGGAGTGTATCCCATAATGAACCAGATATTGCTGCTTCTTTTTGGCGAAGGAGCAGGAGGAAGGCCATAAATGAACCAAGGACTGCAAGTTCAAGTCCAGAGCATCCTTCGTTTAGAGCACGCGGTCGATCCATGCTTGGTGGTGATAAAAGATCATTTAGAGACTATCCTGATGATGTCGGTCCCTCAAGGTCAGAAGGCACATCAAC...
390 bp · TkA05G464140|TK1151|CDS
ATGATGCGGTCTGCTTCCTCCATTGATGGAAAGTGGAGTGTATCCCATAATGAACCAGATATTGCTGCTTCTTTTTGGCGAAGGAGCAGGAGGAAGGCCATAAATGAACCAAGGACTGCAAGTTCAAGTCCAGAGCATCCTTCGTTTAGAGCACGCGGTCGATCCATGCTTGGTGGTGATAAAAGATCATTTAGAGACTATCCTGATGATGTCGGTCCCTCAAGGTCAGAAGGCACATCAACATCTGAACATCGTAGAAA...
Protein
Download Protein FASTA129 aa · TkA05G464140|TK1151|PROTEIN
MMRSASSIDGKWSVSHNEPDIAASFWRRSRRKAINEPRTASSSPEHPSFRARGRSMLGGDKRSFRDYPDDVGPSRSEGTSTSEHRRNRRRSISITPEIGDDIVRLVFSNFLTQKVISLFLCYVLFSLSR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G464140 |
|---|---|
| TK1151 ID | TkA05G464140 |
| OH-1004 ID | LXL04_020103 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 97.200 |
| Protein coverage (%) | TK1151 82.171 / OH-1004 13.384Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G464140 |
|---|---|
| Location | Chr05:116255535-116256406 (+) |
| Description | Similar to SIS8: Probable serine/threonine-protein kinase SIS8 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000165 MAPK cascade Biological Process GO:0001666 response to hypoxia Biological Process GO:0002229 defense response to oomycetes Biological Process GO:0007165 signal transduction Biological Process GO:0009414 response to water deprivation Biological Process GO:0009617 response to bacterium Biological Process GO:0009620 response to fungus Biological Process GO:0009651 response to salt stress Biological Process GO:0009686 gibberellin biosynthetic process Biological Process GO:0009723 response to ethylene Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009744 response to sucrose Biological Process |
| KEGG gene cross-reference | ath:AT1G08720 ath:AT1G73660 ath:AT5G03730 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16527CpxA_peri19-59 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G464140 | PF16527 | CpxA_peri | 19 | 59 | 0.23 | 12.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.