TkA05G462870 | RubberDandelionOmics

Gene overview

TkA05G462870

Reference: TK1151 Chr: Chr05 Coordinates: 115932972-115935929 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1554 bp · TkA05G462870|TK1151|cDNA

ATGTTATCTTCTGGAAAGCATAATTTCAAAAGGAAGAAGACAGATTTGGCTGATATACCAATATTTGACTTATCATCTGACGACGAAGAGATTGATGAACCAATTGTAGATGATAGAATCCTGCCTATATCCAAAGGCAAAGTTATGGAAGAAAGAAGCGCTAAGAGGTCAAATAAAGAAGGATCTAAAAACAAAACCGATTCACCTGATATTAATTTAATACGATTCTTGAAGTCTATGTTGGATTCAACAAATAAGTT...

CDS

Download CDS FASTA

1554 bp · TkA05G462870|TK1151|CDS

ATGTTATCTTCTGGAAAGCATAATTTCAAAAGGAAGAAGACAGATTTGGCTGATATACCAATATTTGACTTATCATCTGACGACGAAGAGATTGATGAACCAATTGTAGATGATAGAATCCTGCCTATATCCAAAGGCAAAGTTATGGAAGAAAGAAGCGCTAAGAGGTCAAATAAAGAAGGATCTAAAAACAAAACCGATTCACCTGATATTAATTTAATACGATTCTTGAAGTCTATGTTGGATTCAACAAATAAGTT...

Protein

Download Protein FASTA

517 aa · TkA05G462870|TK1151|PROTEIN

MLSSGKHNFKRKKTDLADIPIFDLSSDDEEIDEPIVDDRILPISKGKVMEERSAKRSNKEGSKNKTDSPDINLIRFLKSMLDSTNKLVKCYRMARDCLNENPHVDLKLRLIGRRQSDGRTYNLPTSSEVAALIVGDIGESLDNRDIVVKTKSGRLQHISELHPSYLPLQYPLLFPYGDDGYRVDIPHRDVLTTSTSKKNCTMRQFFAYRIQDRDKQFSLIINSKRLFQQFLVDAYTMIESERLYFIRNQQTNLRCETYEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G462870`
TK1151 ID	TkA05G462870
OH-1004 ID	LXL04_006090
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	73.800
Protein coverage (%)	TK1151 96.905 / OH-1004 39.056 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G462870`
Location	Chr05:115932972-115935929 (+)
Description	Similar to RPA1A: Replication protein A 70 kDa DNA-binding subunit A
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006090` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.935

Rank 1 · TkA05G462870 · TK1151

Cytoplasm0.133

Rank 2 · TkA05G462870 · TK1151

Mitochondrion0.030

Rank 3 · TkA05G462870 · TK1151

Cell membrane0.013

Rank 4 · TkA05G462870 · TK1151

Extracellular0.008

Rank 5 · TkA05G462870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14214Helitron_like_N205-303 aa

PF23343REP_ORF2-G2P290-333 aa

PF14214Helitron_like_N303-319 aa

PF20199RepSA303-321 aa

PF23343REP_ORF2-G2P437-459 aa

PF20199RepSA441-462 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G462870	`PF14214`	Helitron_like_N	205	303	3.4e-26	93.4
TkA05G462870	`PF23343`	REP_ORF2-G2P	290	333	3e-06	28.1
TkA05G462870	`PF14214`	Helitron_like_N	303	319	3.4e-26	93.4
TkA05G462870	`PF20199`	RepSA	303	321	0.018	14.9
TkA05G462870	`PF23343`	REP_ORF2-G2P	437	459	3e-06	28.1
TkA05G462870	`PF20199`	RepSA	441	462	0.018	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card