RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G458620
Reference: TK1151 Chr: Chr05 Coordinates: 114924728-114926858 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1129 bp · TkA05G458620|TK1151|cDNA

AGATCTTCTTCATTTTTTAAGCTATTCTTCTTCGTATAAATTCCCATTTGGCCAGCTCCAGAACAGTGTCGGCTCCTCTTAAAATGGCGGCTGCTTCATTTTCTTGTGAGATGTTTGCTCCTTTCCGTGGTGGCTTATTTGGCTGGCGGCTCAGGCGGCTTCTGAAATAAGCAAGGCTTCAGCATAGTGTCTCATGCCTTACGTGTTCCTTCGCAAATGGATTGCCTAGCCGTCCCTTATGTAAGCATGATCGAGTATTA...

CDS

Download CDS FASTA

543 bp · TkA05G458620|TK1151|CDS

ATGACAAAGAAATTAACGTTAAAACTTTGCACGACTCTTGGCGCACTAGATTTTGTGTGTCACTACATCCAAGGAAATGAAAGCTTTGGTGTGCAGAAGCCTCGCCGACCCAACAACGCTACAGGATTCACACCGCTCTCACTGTCTCAACATCTCATACTATCCCCAAACTCAGTTCTCCAACTTCAATCAGAGTTCAAATCAAATCTGTCACCTTCAATTTTCCAAGTACGTCGTCCAAGCTCTCGTGTGGCTACTCA...

Protein

Download Protein FASTA

180 aa · TkA05G458620|TK1151|PROTEIN

MTKKLTLKLCTTLGALDFVCHYIQGNESFGVQKPRRPNNATGFTPLSLSQHLILSPNSVLQLQSEFKSNLSPSIFQVRRPSSRVATHLNVKVEILHAEGNNYRTAYNYFFEAVEASNAVDDHRAVYSLMYMLLCKIMVNQVDDVAGNWSKGFRQEFEPVTFKKSVVELGAKLSKKQQKKM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G458620
TK1151 IDTkA05G458620
OH-1004 IDLXL04_005687
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)69.500
Protein coverage (%)TK1151 32.778 / OH-1004 12.016
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G458620
LocationChr05:114924728-114926858 (-)
DescriptionSimilar to RPN6: 26S proteasome non-ATPase regulatory subunit 11 homolog
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g29150 Component of the lid subcomplex of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005687 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0006979 response to oxidative stress Biological Process
GO:0010498 proteasomal protein catabolic process Biological Process
GO:0030163 protein catabolic process Biological Process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process
GO:0043248 proteasome assembly Biological Process
GO:0048863 stem cell differentiation Biological Process
GO:0061136 regulation of proteasomal protein catabolic process Biological Process
GO:0071357 cellular response to type I interferon Biological Process
GO:0000502 proteasome complex Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT1G29150
hsa:5717
mmu:69077
rno:303353
xtr:100492225
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.285
Rank 1 · TkA05G458620 · TK1151
Nucleus0.257
Rank 2 · TkA05G458620 · TK1151
Mitochondrion0.256
Rank 3 · TkA05G458620 · TK1151
Endoplasmic reticulum0.144
Rank 4 · TkA05G458620 · TK1151
Cell membrane0.086
Rank 5 · TkA05G458620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LP45Arabidopsis thalianasp|Q9LP45|PSD11_ARATH 26S proteasome non-ATPase regulatory subunit 11 homolog62.700%Swiss-ProtLow

JBrowse

View in Genome Browser