TkA05G457700 | RubberDandelionOmics

Gene overview

TkA05G457700

Reference: TK1151 Chr: Chr05 Coordinates: 114666683-114668262 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1104 bp · TkA05G457700|TK1151|cDNA

ATGCTAAGGAACATGATTGTCTCCAAGTTCAAATTTACCCACAAATTTACAGGTAGAAACAAGAAACAATCTTTGAGTAGCTTTGTGGCCAATGAGACAAATGTTAGTAACGAATACTTCCAAGCGTTTAGGACGAAATCATACATGGGGATTTGCGACAAAATGGAAAGCTACAAAGGTTTCGATAATGAATCAAACTCATCTTCATCATCTATTCATGATCATTATAGTCATCATTGTGACATACTACCCGAACTAGA...

CDS

Download CDS FASTA

1104 bp · TkA05G457700|TK1151|CDS

ATGCTAAGGAACATGATTGTCTCCAAGTTCAAATTTACCCACAAATTTACAGGTAGAAACAAGAAACAATCTTTGAGTAGCTTTGTGGCCAATGAGACAAATGTTAGTAACGAATACTTCCAAGCGTTTAGGACGAAATCATACATGGGGATTTGCGACAAAATGGAAAGCTACAAAGGTTTCGATAATGAATCAAACTCATCTTCATCATCTATTCATGATCATTATAGTCATCATTGTGACATACTACCCGAACTAGA...

Protein

Download Protein FASTA

367 aa · TkA05G457700|TK1151|PROTEIN

MLRNMIVSKFKFTHKFTGRNKKQSLSSFVANETNVSNEYFQAFRTKSYMGICDKMESYKGFDNESNSSSSSIHDHYSHHCDILPELEKETMANLANSTYDNHCLLDFFNGGLEAWKICEKLLHSVHQENENHHSIARIIKLAESVPKKCQMTRMYKELALYSSLENPLSDLSTKMFPKIHNHLKLLLIRIRKNQARLKRKRTIITCLKKVLGCVLVASYTMLVVAMLVLAFHGFVGIVASIGLISCLLGLTKKSNASKKG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G457700`
TK1151 ID	TkA05G457700
OH-1004 ID	LXL04_022304
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G457700

Location Chr05:114666683-114668262 (+)

Description Similar to At1g20180: UPF0496 protein At1g20180

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20180`	UPF0496 protein At1g20180.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0718300`	Putative UPF0496 protein 2.	No verified direct reference in this release
`UniProt: A2YH25`	Putative UPF0496 protein 2.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022304 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G20180

ath:AT3G19330

ath:AT3G49070

dosa:Os03g0148000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.361

Rank 1 · TkA05G457700 · TK1151

Cytoplasm0.335

Rank 2 · TkA05G457700 · TK1151

Nucleus0.259

Rank 3 · TkA05G457700 · TK1151

Endoplasmic reticulum0.121

Rank 4 · TkA05G457700 · TK1151

Mitochondrion0.106

Rank 5 · TkA05G457700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15956DUF476017-143 aa

PF05055DUF677104-362 aa

PF15956DUF4760286-334 aa

PF18881DUF5646307-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G457700	`PF15956`	DUF4760	17	143	0.24	12.3
TkA05G457700	`PF05055`	DUF677	104	362	7.5e-13	48.8
TkA05G457700	`PF15956`	DUF4760	286	334	0.24	12.3
TkA05G457700	`PF18881`	DUF5646	307	343	0.27	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6DYE5`	Arabidopsis thaliana	sp\|Q6DYE5\|U496K_ARATH UPF0496 protein At1g20180	31.200%	Swiss-Prot	Medium
`Q5Z8N6`	Oryza sativa subsp. japonica	sp\|Q5Z8N6\|U496B_ORYSJ Putative UPF0496 protein 2	31.300%	Swiss-Prot	Medium
`A2YH25`	Oryza sativa subsp. indica	sp\|A2YH25\|U496B_ORYSI Putative UPF0496 protein 2	30.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card