TkA05G456490 | RubberDandelionOmics

Gene overview

TkA05G456490

Reference: TK1151 Chr: Chr05 Coordinates: 114348644-114349335 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

594 bp · TkA05G456490|TK1151|cDNA

GATATCTTCCATCTCCATTTCCCTTTCACAATGCTTCGTGTTTAACAGATGGAATACCGATTGCTGTAACATCACCTGCTCTTTTGGTGTCTTATGATGAAGACGATTGCTATTGCCGCTTCCAGTCAAACTACTAAACTCAGAAAGTGTCATCAGTTACGCCGTGCATTTTACTCGAATCTTCCTCATGCTCCCAGAAATCTTGAAGGATGTTCAAATAAGTATAGTTCCCATTATGGTGACCTAGGTGATGCATTCTT...

CDS

Download CDS FASTA

501 bp · TkA05G456490|TK1151|CDS

ATGATGAAGACGATTGCTATTGCCGCTTCCAGTCAAACTACTAAACTCAGAAAGTGTCATCAGTTACGCCGTGCATTTTACTCGAATCTTCCTCATGCTCCCAGAAATCTTGAAGGATGTTCAAATAAGTATAGTTCCCATTATGGTGACCTAGGTGATGCATTCTTGGTGTTTGATAAAATGCTTCAAAGACGACCTCTTCCCTCAATTGTAAACTTCAACAAAGTTTTCTCATCTCTCGTCAAATTCAAGCATTACTC...

Protein

Download Protein FASTA

167 aa · TkA05G456490|TK1151|PROTEIN

MMKTIAIAASSQTTKLRKCHQLRRAFYSNLPHAPRNLEGCSNKYSSHYGDLGDAFLVFDKMLQRRPLPSIVNFNKVFSSLVKFKHYSTAISMIQRLGLLGLNPLVKPDIYSFHIAINCFCHSDRVCFGFCIFGSVIKLGYEPDCHMFNTLIWGLCNDGKLYQAVTLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G456490`
TK1151 ID	TkA05G456490
OH-1004 ID	LXL04_022289
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.600
Protein coverage (%)	TK1151 100.000 / OH-1004 21.611 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G456490

Location Chr05:114348644-114349335 (+)

Description Similar to At1g12700: Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12775`	Pentatricopeptide repeat-containing protein At1g12775, mitochondrial.	No verified direct reference in this release
`At1g12300`	Pentatricopeptide repeat-containing protein At1g12300, mitochondrial.	No verified direct reference in this release
`At1g62680`	Pentatricopeptide repeat-containing protein At1g62680, mitochondrial.	No verified direct reference in this release
`At3g22470`	Pentatricopeptide repeat-containing protein At3g22470, mitochondrial.	No verified direct reference in this release
`At1g62720`	Pentatricopeptide repeat-containing protein At1g62720.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022289 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0080156 mitochondrial mRNA modification Biological Process

GO:0090615 mitochondrial mRNA processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G12300

ath:AT1G12700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.807

Rank 1 · TkA05G456490 · TK1151

Plastid0.074

Rank 2 · TkA05G456490 · TK1151

Nucleus0.038

Rank 3 · TkA05G456490 · TK1151

Cytoplasm0.033

Rank 4 · TkA05G456490 · TK1151

Cell membrane0.008

Rank 5 · TkA05G456490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_248-82 aa

PF13812PPR_348-78 aa

PF12854PPR_149-61 aa

PF01535PPR49-64 aa

PF13041PPR_268-121 aa

PF01535PPR73-96 aa

PF12854PPR_1105-124 aa

PF13812PPR_3106-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G456490	`PF13041`	PPR_2	48	82	1.4e-10	41.8
TkA05G456490	`PF13812`	PPR_3	48	78	0.0019	19.0
TkA05G456490	`PF12854`	PPR_1	49	61	1.4e-11	44.6
TkA05G456490	`PF01535`	PPR	49	64	8e-07	29.6
TkA05G456490	`PF13041`	PPR_2	68	121	1.4e-10	41.8
TkA05G456490	`PF01535`	PPR	73	96	8e-07	29.6
TkA05G456490	`PF12854`	PPR_1	105	124	1.4e-11	44.6
TkA05G456490	`PF13812`	PPR_3	106	113	0.0019	19.0
TkA05G456490	`PF01535`	PPR	111	124	8e-07	29.6
TkA05G456490	`PF13812`	PPR_3	136	164	0.0019	19.0
TkA05G456490	`PF12854`	PPR_1	139	167	1.4e-11	44.6
TkA05G456490	`PF13041`	PPR_2	142	167	1.4e-10	41.8
TkA05G456490	`PF01535`	PPR	146	167	8e-07	29.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LPX2`	Arabidopsis thaliana	sp\|Q9LPX2\|PPR39_ARATH Pentatricopeptide repeat-containing protein At1g12775, mitochondrial	38.400%	Swiss-Prot	Medium
`Q0WKV3`	Arabidopsis thaliana	sp\|Q0WKV3\|PPR36_ARATH Pentatricopeptide repeat-containing protein At1g12300, mitochondrial	36.700%	Swiss-Prot	Medium
`Q3ECK2`	Arabidopsis thaliana	sp\|Q3ECK2\|PPR92_ARATH Pentatricopeptide repeat-containing protein At1g62680, mitochondrial	44.300%	Swiss-Prot	Low
`Q6NQ83`	Arabidopsis thaliana	sp\|Q6NQ83\|PP247_ARATH Pentatricopeptide repeat-containing protein At3g22470, mitochondrial	33.300%	Swiss-Prot	Medium
`Q9SI78`	Arabidopsis thaliana	sp\|Q9SI78\|PPR93_ARATH Pentatricopeptide repeat-containing protein At1g62720	44.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card