TkA05G454310 | RubberDandelionOmics

Gene overview

TkA05G454310

Reference: TK1151 Chr: Chr05 Coordinates: 113751678-113757958 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2120 bp · TkA05G454310|TK1151|cDNA

TTTTAATTAATTTCCCCCTCGAATCTTCACCTCTCTCTCTTTTAATCCCCTCCCCCCTCCACCGCCATCACTCTGTAGTCTGTACTGCACTTCAATTCCTCATTTACTTCAATCTTCACATTTCGCCTCTCTCCATTTTCAAAGAGAGAGATAGTATTTGCGTGAATCACCGATGAAGATATTGCCGCGAAATTTGGCGGTTTGTATCACTGTCGGTGCTTTCCTCATTGCCATTACCGGCGCCGAAGATCCGTACAGAT...

CDS

Download CDS FASTA

1632 bp · TkA05G454310|TK1151|CDS

ATGAAGATATTGCCGCGAAATTTGGCGGTTTGTATCACTGTCGGTGCTTTCCTCATTGCCATTACCGGCGCCGAAGATCCGTACAGATTCTTCGAATGGAATGTCACATACTGCGACATTTATCCGCTCGGTGTTCGTCAACAGGGGATTTTGATCAATGGTCAGTTTCCTGGGCCTGATATTCATTCAGTTACAAATGACAATCTAATCATCAATGTCTTCAACAGCTTAGACGAGCCTTTTCTTATTTCCTGGAATGG...

Protein

Download Protein FASTA

543 aa · TkA05G454310|TK1151|PROTEIN

MKILPRNLAVCITVGAFLIAITGAEDPYRFFEWNVTYCDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLISWNGVQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRILSRPRIPVPFDEPADDFTVLIGDWYKSNHTTLKAILDRGHKLRSPDGILINGRGPNGASFTVQHGKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTVQQMYSSLDVHCGQS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G454310`
TK1151 ID	TkA05G454310
OH-1004 ID	LXL04_035741
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.900
Protein coverage (%)	TK1151 99.448 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G454310

Location Chr05:113751678-113757958 (+)

Description Similar to L-ascorbate oxidase homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55560`	Probable oxidoreductase that may be involved in pollen tube growth.	Two Arabidopsis late pollen transcripts are detected in cytoplasmic granules.2017 · DOI: 10.1002/pld3.12
`At4g12420`	May be a monocopper oxidase of unknown specificity.	No verified direct reference in this release
`At4g25240`	Monocopper oxidase-like protein SKS1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035741 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009932 cell tip growth Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0048046 apoplast Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G55560

ath:AT4G12420

ath:AT5G51480

bna:106452325

nta:107766889

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.813

Rank 1 · TkA05G454310 · TK1151

Cytoplasm0.058

Rank 2 · TkA05G454310 · TK1151

Cell membrane0.051

Rank 3 · TkA05G454310 · TK1151

Endoplasmic reticulum0.035

Rank 4 · TkA05G454310 · TK1151

Nucleus0.030

Rank 5 · TkA05G454310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07732Cu-oxidase_335-148 aa

PF00394Cu-oxidase47-55 aa

PF07731Cu-oxidase_286-138 aa

PF00394Cu-oxidase106-131 aa

PF00394Cu-oxidase161-297 aa

PF07732Cu-oxidase_3192-226 aa

PF07731Cu-oxidase_2199-223 aa

PF18560Lectin_like205-282 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G454310	`PF07732`	Cu-oxidase_3	35	148	3.7e-38	130.9
TkA05G454310	`PF00394`	Cu-oxidase	47	55	3.5e-44	151.4
TkA05G454310	`PF07731`	Cu-oxidase_2	86	138	3.4e-32	111.8
TkA05G454310	`PF00394`	Cu-oxidase	106	131	3.5e-44	151.4
TkA05G454310	`PF00394`	Cu-oxidase	161	297	3.5e-44	151.4
TkA05G454310	`PF07732`	Cu-oxidase_3	192	226	3.7e-38	130.9
TkA05G454310	`PF07731`	Cu-oxidase_2	199	223	3.4e-32	111.8
TkA05G454310	`PF18560`	Lectin_like	205	282	0.084	13.8
TkA05G454310	`PF07731`	Cu-oxidase_2	378	516	3.4e-32	111.8
TkA05G454310	`PF00394`	Cu-oxidase	437	453	3.5e-44	151.4
TkA05G454310	`PF31114`	DUF8814	466	501	0.11	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SMW3`	Arabidopsis thaliana	sp\|Q9SMW3\|SKS14_ARATH Protein SKU5 SIMILAR 14	53.700%	Swiss-Prot	High
`Q9SU40`	Arabidopsis thaliana	sp\|Q9SU40\|SKU5_ARATH Monocopper oxidase-like protein SKU5	51.400%	Swiss-Prot	High
`Q8VXX5`	Arabidopsis thaliana	sp\|Q8VXX5\|SKS1_ARATH Monocopper oxidase-like protein SKS1	48.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card