TkA05G453410 | RubberDandelionOmics

Gene overview

TkA05G453410

Reference: TK1151 Chr: Chr05 Coordinates: 113489523-113490385 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

804 bp · TkA05G453410|TK1151|cDNA

ATGCTCATCACCACAGATCCACTAGACATCAACCACATTTTGAGCAAGAACTTCAATAACTACCCAAAGGGTGAAAATTTCCGTAAATTGTTTGATCCCCTTGGAGATGGAGTCATTAATGTAGACGGACATTTATGGGAGATCCATCGCAAAAGCATTAAGTCCCTCTTAAGGCTACCCAACTTTCAAAGTGATTTTGAAGCGATTATATGGAATAAAGTGGAAACAGGGCTTTTACAGATATTAGATTCTTTTTCCAA...

CDS

Download CDS FASTA

804 bp · TkA05G453410|TK1151|CDS

ATGCTCATCACCACAGATCCACTAGACATCAACCACATTTTGAGCAAGAACTTCAATAACTACCCAAAGGGTGAAAATTTCCGTAAATTGTTTGATCCCCTTGGAGATGGAGTCATTAATGTAGACGGACATTTATGGGAGATCCATCGCAAAAGCATTAAGTCCCTCTTAAGGCTACCCAACTTTCAAAGTGATTTTGAAGCGATTATATGGAATAAAGTGGAAACAGGGCTTTTACAGATATTAGATTCTTTTTCCAA...

Protein

Download Protein FASTA

267 aa · TkA05G453410|TK1151|PROTEIN

MLITTDPLDINHILSKNFNNYPKGENFRKLFDPLGDGVINVDGHLWEIHRKSIKSLLRLPNFQSDFEAIIWNKVETGLLQILDSFSKQGKEMDLQEIFQRFTFDTICEKAITNIHEGLFYRHLVPTIFRKFQQLLRTGNERKLSEACNTIDDCIYEFMARKQKESSNLESEHGNQNFGLATSLLREFKDRSDSYVDPKKFMRDTNLVGAGKDTTSIALSWFFYLVAKNPTVEEKIREEIHAFMVHGQRWSSKELGFRKTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G453410`
TK1151 ID	TkA05G453410
OH-1004 ID	LXL04_022250
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	62.000
Protein coverage (%)	TK1151 95.506 / OH-1004 56.914 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G453410

Location Chr05:113489523-113490385 (+)

Description Similar to CYP96A15: Alkane hydroxylase MAH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g57750`	Involved in the formation of secondary alcohols and ketones in stem cuticular wax.	The cytochrome P450 enzyme CYP96A15 is the midchain alkane hydroxylase responsible for formation of secondary alcohols and ketones in stem cuticular wax of Arabidopsis.2007 · DOI: 10.1104/pp.107.107300
`At5g23190`	Involved in very long chain fatty acids (VLCFA) omega- hydroxylation.	CYP86B1 is required for very long chain omega-hydroxyacid and alpha, omega -dicarboxylic acid synthesis in root and seed suberin polyester.2009 · DOI: 10.1104/pp.109.141408 Identification of an Arabidopsis feruloyl-coenzyme A transferase required for suberin synthesis.2009 · DOI: 10.1104/pp.109.144907
`At1g63710`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335
`At2g45970`	Catalyzes the omega-hydroxylation of various fatty acids (FA).	Functional analysis of the LACERATA gene of Arabidopsis provides evidence for different roles of fatty acid omega -hydroxylation in development.2001 · DOI: 10.1073/pnas.171285998 Molecular definitions of fatty acid hydroxylases in Arabidopsis thaliana.2007 · DOI: 10.1002/prot.21335

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022250 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

GO:0080133 midchain alkane hydroxylase activity Molecular Function

KEGG gene cross-reference

ag:AMO65741

ath:AT1G57750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.883

Rank 1 · TkA05G453410 · TK1151

Cytoplasm0.091

Rank 2 · TkA05G453410 · TK1151

Nucleus0.044

Rank 3 · TkA05G453410 · TK1151

Lysosome / Vacuole0.038

Rank 4 · TkA05G453410 · TK1151

Golgi apparatus0.032

Rank 5 · TkA05G453410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p4502-248 aa

PF26137Toxin_SdpC123-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G453410	`PF00067`	p450	2	248	1.5e-25	90.6
TkA05G453410	`PF26137`	Toxin_SdpC	123	171	0.4	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVS9`	Arabidopsis thaliana	sp\|Q9FVS9\|C96AF_ARATH Alkane hydroxylase MAH1	35.100%	Swiss-Prot	Medium
`Q9FMY1`	Arabidopsis thaliana	sp\|Q9FMY1\|C86B1_ARATH Cytochrome P450 86B1	34.600%	Swiss-Prot	Medium
`Q9CAD6`	Arabidopsis thaliana	sp\|Q9CAD6\|C86A7_ARATH Cytochrome P450 86A7	28.900%	Swiss-Prot	Low
`O80823`	Arabidopsis thaliana	sp\|O80823\|C86A8_ARATH Cytochrome P450 86A8	28.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card