TkA05G453350 | RubberDandelionOmics

Gene overview

TkA05G453350

Reference: TK1151 Chr: Chr05 Coordinates: 113471328-113472731 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1347 bp · TkA05G453350|TK1151|cDNA

ATGGTACCAGCAGTCCTCACAAACTTGCACCAGGTACATGATTTGGCCACGACTTATCTGACACAAAATGGTGGTACTTTCATGTTCAGAGGCCCTTGGTTCGCCAAAATGGATATGCTCATTACCACAGATCCATCAGATATCCAACACATTTTGAGCAAGAACTTTTCTAATTATCCTAAAGGCGAAAAATTCCGTAAATTGTTTGATGTTCTTGGAGATGGAATATTTAACGCTGATGGACACATTTGGGAGATCCA...

CDS

Download CDS FASTA

1347 bp · TkA05G453350|TK1151|CDS

ATGGTACCAGCAGTCCTCACAAACTTGCACCAGGTACATGATTTGGCCACGACTTATCTGACACAAAATGGTGGTACTTTCATGTTCAGAGGCCCTTGGTTCGCCAAAATGGATATGCTCATTACCACAGATCCATCAGATATCCAACACATTTTGAGCAAGAACTTTTCTAATTATCCTAAAGGCGAAAAATTCCGTAAATTGTTTGATGTTCTTGGAGATGGAATATTTAACGCTGATGGACACATTTGGGAGATCCA...

Protein

Download Protein FASTA

448 aa · TkA05G453350|TK1151|PROTEIN

MVPAVLTNLHQVHDLATTYLTQNGGTFMFRGPWFAKMDMLITTDPSDIQHILSKNFSNYPKGEKFRKLFDVLGDGIFNADGHIWEIQRKTTMSLFKQPNFQHVFEAIVWNKVERGLLPVLESVCKQGKEMDLQETFQKFTFDTICKLLLDHDPQSLSLDRHCLPCEKAITDIQEGIFYRHLMPPIIWKLQQLLGMGNEKKLSEACNVIDQFIYKGLARVQNESNNIESEHGQENVGIGASLIREFKDQSAGKDTTGTTLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G453350`
TK1151 ID	TkA05G453350
OH-1004 ID	LXL04_022250
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.200
Protein coverage (%)	TK1151 98.438 / OH-1004 92.986 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G453350

Location Chr05:113471328-113472731 (+)

Description Similar to CYP96A15: Alkane hydroxylase MAH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g57750`	Involved in the formation of secondary alcohols and ketones in stem cuticular wax.	The cytochrome P450 enzyme CYP96A15 is the midchain alkane hydroxylase responsible for formation of secondary alcohols and ketones in stem cuticular wax of Arabidopsis.2007 · DOI: 10.1104/pp.107.107300

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022250 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004497 monooxygenase activity Molecular Function

GO:0005506 iron ion binding Molecular Function

GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Molecular Function

GO:0020037 heme binding Molecular Function

GO:0080133 midchain alkane hydroxylase activity Molecular Function

KEGG gene cross-reference

ag:AMO65741

ath:AT1G57750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.892

Rank 1 · TkA05G453350 · TK1151

Cytoplasm0.064

Rank 2 · TkA05G453350 · TK1151

Cell membrane0.032

Rank 3 · TkA05G453350 · TK1151

Mitochondrion0.030

Rank 4 · TkA05G453350 · TK1151

Nucleus0.028

Rank 5 · TkA05G453350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45032-424 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G453350	`PF00067`	p450	32	424	5.5e-53	181.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVS9`	Arabidopsis thaliana	sp\|Q9FVS9\|C96AF_ARATH Alkane hydroxylase MAH1	42.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card