TkA05G453030 | RubberDandelionOmics

Gene overview

TkA05G453030

Reference: TK1151 Chr: Chr05 Coordinates: 113407921-113409877 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1699 bp · TkA05G453030|TK1151|cDNA

TATTTATCTAGGGAGTAACTAGTAAGTGATAAATATTTATAGGTTGCTCCATTTATGTTTGCTAGCTAGCTTATTACACTCCACTCCATCAATATGGCCGTATTCTGTACCCTTCCTCTTCTCCTCCACCTCGTCGGCCTACTTCCCACCTTCTCCGCCGTCGGTATAAACTACGGCACGCTAGGAAACAACCTTCCTCCACCAAAAACAGTAGCCCAACTCCTCCAGTCCACTCTTATTGATAAAGTCAAAATCTACGA...

CDS

Download CDS FASTA

1380 bp · TkA05G453030|TK1151|CDS

ATGGCCGTATTCTGTACCCTTCCTCTTCTCCTCCACCTCGTCGGCCTACTTCCCACCTTCTCCGCCGTCGGTATAAACTACGGCACGCTAGGAAACAACCTTCCTCCACCAAAAACAGTAGCCCAACTCCTCCAGTCCACTCTTATTGATAAAGTCAAAATCTACGACTCCAACCCTCAAATCCTCCAAGCCTTCTCCAACTCCGGCATCGACCTCATAGTCGCTGTCGAGAACAACCATGTCGCTAACCTAAGCTCCAC...

Protein

Download Protein FASTA

459 aa · TkA05G453030|TK1151|PROTEIN

MAVFCTLPLLLHLVGLLPTFSAVGINYGTLGNNLPPPKTVAQLLQSTLIDKVKIYDSNPQILQAFSNSGIDLIVAVENNHVANLSSTKSAAEDWFSARVAPFIPATSIVAIAVGNEYLATDDDSLDPNALIQAMQNLHEVLLSSGLDRKIKITTPHSMAVLATSFPPSASTFATTLMPTMTSIVTFLADTGSPFMVNAYPYFAYRDNPTTVELEYALLGNSTGVHDPKGYVYTNMLDAQIDAIRSAIASLGFGNRSIHIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G453030`
TK1151 ID	TkA05G453030
OH-1004 ID	LXL04_022242
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G453030

Location Chr05:113407921-113409877 (-)

Description Similar to At5g56590: Glucan endo-1,3-beta-glucosidase 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g29360`	Glucan endo-1,3-beta-glucosidase 12.	No verified direct reference in this release
`At4g34480`	Glucan endo-1,3-beta-glucosidase 7.	No verified direct reference in this release
`At5g56590`	Glucan endo-1,3-beta-glucosidase 13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022242 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006076 (1->3)-beta-D-glucan catabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G01630

ath:AT4G29360

ath:AT4G34480

ath:AT5G56590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.306

Rank 1 · TkA05G453030 · TK1151

Cell membrane0.290

Rank 2 · TkA05G453030 · TK1151

Endoplasmic reticulum0.119

Rank 3 · TkA05G453030 · TK1151

Cytoplasm0.118

Rank 4 · TkA05G453030 · TK1151

Lysosome / Vacuole0.115

Rank 5 · TkA05G453030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00332Glyco_hydro_1723-343 aa

PF29664BtgE-BtgC_glyc-hydro42-330 aa

PF07983X8372-442 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G453030	`PF00332`	Glyco_hydro_17	23	343	9.1e-82	275.8
TkA05G453030	`PF29664`	BtgE-BtgC_glyc-hydro	42	330	1.9e-15	57.5
TkA05G453030	`PF07983`	X8	372	442	1.2e-19	71.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYE5`	Arabidopsis thaliana	sp\|Q8VYE5\|E1312_ARATH Glucan endo-1,3-beta-glucosidase 12	41.800%	Swiss-Prot	Medium
`Q9M069`	Arabidopsis thaliana	sp\|Q9M069\|E137_ARATH Glucan endo-1,3-beta-glucosidase 7	43.000%	Swiss-Prot	Medium
`Q9FJU9`	Arabidopsis thaliana	sp\|Q9FJU9\|E1313_ARATH Glucan endo-1,3-beta-glucosidase 13	41.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card