TkA05G451800 | RubberDandelionOmics

Gene overview

TkA05G451800

Reference: TK1151 Chr: Chr05 Coordinates: 113068827-113072709 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1984 bp · TkA05G451800|TK1151|cDNA

AGCCCCATTACTCGTGTATGGGCTATGAACATCGATGGTGCTTTCGAGAGGGAGACCCGTTCCTGATTTGACGAAGAAACCGCAGATGGAAGCAGACACAAATGCTAACACCACCGCCGTGCCTCTGAGCTGATGCACTGACCGGCGTTACAATTTTCAGCCGCTCGACCAATCACGTGCCCCCACCTGTCCCCTCTCTCCCCCATCGCATTTCACAAAACCTCGCCACACATAAATAAGCGTTACGTACGTAAAAACAC...

CDS

Download CDS FASTA

1383 bp · TkA05G451800|TK1151|CDS

ATGGATGAAAGGGATGTGGCTATGGAGGACACTGGAAAGCTTCTAGAACATGAAGTAGTAGGTGGTGAAGAATCTTTGGAAAAAAACCAGCTCAATGAAAAAGAATCAGACACACAACAGTCTTCTGATGTTCAAATCCCAAATGAAATTGGAGTAGACCAAGAAAAACAAAGCAAGGAGGAATCACCTGTGGGTGAGACTCGGGATAGTGAGAAAGATACTCCATTAATGGATGATGAAGGTAGAAAAGATGCTACAAC...

Protein

Download Protein FASTA

460 aa · TkA05G451800|TK1151|PROTEIN

MDERDVAMEDTGKLLEHEVVGGEESLEKNQLNEKESDTQQSSDVQIPNEIGVDQEKQSKEESPVGETRDSEKDTPLMDDEGRKDATTMDDDGNKDDENGVVDEADNDASMKILENNNEGVDEKHQEPVTSNSIVIHPPTKVQDHGVETLKNEIEDTKMDEGYESGTAEDQETFMKEVEALYKEKNLEFKPPKFYGQPLNCLKLWRSVIKLGGYDRVTGSKWWRQVGEAFHPPKTCTTVSWTFRQFYEKALLEYERHKIQT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G451800`
TK1151 ID	TkA05G451800
OH-1004 ID	LXL04_022219
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G451800

Location Chr05:113068827-113072709 (+)

Description Similar to ARID5: AT-rich interactive domain-containing protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76510`	AT-rich interactive domain-containing protein 5.	No verified direct reference in this release
`At2g17410`	AT-rich interactive domain-containing protein 3.	No verified direct reference in this release
`At1g20910`	AT-rich interactive domain-containing protein 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022219 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006337 nucleosome disassembly Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process

GO:0030336 negative regulation of cell migration Biological Process

GO:0042592 homeostatic process Biological Process

GO:0045597 positive regulation of cell differentiation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

KEGG gene cross-reference

ath:AT1G20910

ath:AT1G76510

ath:AT2G17410

hsa:196528

mmu:77044

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA05G451800 · TK1151

Cytoplasm0.077

Rank 2 · TkA05G451800 · TK1151

Cell membrane0.023

Rank 3 · TkA05G451800 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA05G451800 · TK1151

Plastid0.009

Rank 5 · TkA05G451800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29538Ig_CMFA_2nd41-98 aa

PF01388ARID170-254 aa

PF00011HSP20376-458 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G451800	`PF29538`	Ig_CMFA_2nd	41	98	0.64	11.0
TkA05G451800	`PF01388`	ARID	170	254	2.4e-19	70.3
TkA05G451800	`PF00011`	HSP20	376	458	4.9e-05	24.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WNR6`	Arabidopsis thaliana	sp\|Q0WNR6\|ARID5_ARATH AT-rich interactive domain-containing protein 5	67.300%	Swiss-Prot	Medium
`Q940Y3`	Arabidopsis thaliana	sp\|Q940Y3\|ARID3_ARATH AT-rich interactive domain-containing protein 3	62.500%	Swiss-Prot	Medium
`C0SUW7`	Arabidopsis thaliana	sp\|C0SUW7\|ARID6_ARATH AT-rich interactive domain-containing protein 6	57.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card