TkA05G451450 | RubberDandelionOmics

Gene overview

TkA05G451450

Reference: TK1151 Chr: Chr05 Coordinates: 112932390-112935816 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1530 bp · TkA05G451450|TK1151|cDNA

TTCAATTACGGTAATTATAAAGCATGGACATCTGAAGCATACGCGCTCTCTTCTGCTGTGCATACCCATCGTAGTACAAGTACAACCGGAGACGAGCCGAAGAAAAGGAACCACCGCCGGCGGTAGTCGATTCTCGATTCCGTTTTTTCTTAAGACCATAGATCCAGCCTCTAACTATCAACAAAAGCTTCACTTAACACCTGGATTTCTTCTGAAATCACTGATTTGTACTTCCAACAATGAAGAACGGTGAACTCGCC...

CDS

Download CDS FASTA

1029 bp · TkA05G451450|TK1151|CDS

ATGAAGAACGGTGAACTCGCCGCCAACATTGCCTTAGCAGCTTTAACATTGGCCCCGTTAGTTGTGAAAGTAGACACAAATCTAAATGTTGTATTAACAGCATGCCTCACGGTTTTTGTGGGCTGCTACCGCTCTGTCAAACCAACACCTCCTTCTGAAACAATGTCTAATGAACACGCGATGCGTTTTCCTTTAGTTGGGAGTGCAATGTTGTTATCTTTGTTCTTACTCTTCAAATTCCTATCAAAAGACTTGGTCAA...

Protein

Download Protein FASTA

342 aa · TkA05G451450|TK1151|PROTEIN

MKNGELAANIALAALTLAPLVVKVDTNLNVVLTACLTVFVGCYRSVKPTPPSETMSNEHAMRFPLVGSAMLLSLFLLFKFLSKDLVNAVLTGYFFILGIIALSATLLPAIAQYLPKKWNDDVIVWRLPYFRSLDVTFEFTISQAVAAIPGTFFCAWYAAQKHWLANNILGLAFCIQGIEMLSLGSFKTGAILLAGLFVYDIFWVFFTPVMVSVAKSFDAPIKLLFPSRIAARPFSMLGLGDIVIPGIFVALALRFDVSRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G451450`
TK1151 ID	TkA05G451450
OH-1004 ID	LXL04_022215
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G451450

Location Chr05:112932390-112935816 (+)

Description Similar to SPP: Signal peptide peptidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g03120`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane (By similarity).	The signal peptide peptidase is required for pollen function in Arabidopsis.2009 · DOI: 10.1104/pp.108.130252

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0117400`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release
`Os05g0436400`	Intramembrane-cleaving aspartic protease (I-CLiP) that cleaves type II membrane signal peptides in the hydrophobic plane of the membrane.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022215 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006465 signal peptide processing Biological Process

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0033619 membrane protein proteolysis Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:1904211 membrane protein proteolysis involved in retrograde protein transport, ER to cytosol Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005791 rough endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009986 cell surface Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G03120

dosa:Os02g0117400

dosa:Os05g0436400

hsa:81502

mmu:14950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.852

Rank 1 · TkA05G451450 · TK1151

Golgi apparatus0.124

Rank 2 · TkA05G451450 · TK1151

Nucleus0.071

Rank 3 · TkA05G451450 · TK1151

Cytoplasm0.065

Rank 4 · TkA05G451450 · TK1151

Cell membrane0.041

Rank 5 · TkA05G451450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04258Peptidase_A22B50-324 aa

PF04246RseC_MucC69-103 aa

PF01080Presenilin82-106 aa

PF06550SPP151-305 aa

PF01080Presenilin188-205 aa

PF01080Presenilin237-310 aa

PF04246RseC_MucC262-307 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G451450	`PF04258`	Peptidase_A22B	50	324	5.2e-88	296.1
TkA05G451450	`PF04246`	RseC_MucC	69	103	6.5	7.4
TkA05G451450	`PF01080`	Presenilin	82	106	0.015	14.8
TkA05G451450	`PF06550`	SPP	151	305	2.3e-05	24.8
TkA05G451450	`PF01080`	Presenilin	188	205	0.015	14.8
TkA05G451450	`PF01080`	Presenilin	237	310	0.015	14.8
TkA05G451450	`PF04246`	RseC_MucC	262	307	6.5	7.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81062`	Arabidopsis thaliana	sp\|O81062\|SIP_ARATH Signal peptide peptidase	81.000%	Swiss-Prot	High
`Q6ZGL9`	Oryza sativa subsp. japonica	sp\|Q6ZGL9\|SIP1_ORYSJ Signal peptide peptidase 1	80.800%	Swiss-Prot	High
`B9FJ61`	Oryza sativa subsp. japonica	sp\|B9FJ61\|SIP2_ORYSJ Signal peptide peptidase 2	80.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card