TkA05G450100 | RubberDandelionOmics

Gene overview

TkA05G450100

Reference: TK1151 Chr: Chr05 Coordinates: 112530935-112532549 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · TkA05G450100|TK1151|cDNA

ATGCCAACACCTTTCTCTCACCTCCACATAACACACACATACTCCCAGATGCTAACACCATTTCTCACTAGTAAAATCACACAAACTTAATTAATCCCACACTCAATCAATAGCAAAGGAGATCTACCATGGCAGATAAGGTTGCAGACGCGATGTTGACCGCCGCTGATAAAGCTCCGGTGACCTCCGACAGAAAGATTCGGTCAGACCTCGACAACAAGCTCCCTAAGCCATATATGGCACGAGCGGTGACTGCCCCT...

CDS

Download CDS FASTA

417 bp · TkA05G450100|TK1151|CDS

ATGGTATACGCCCATCTAGCTATGAGTTACGTCACTTTGCCTACTTGGTTGCCATCGCCTTTCTTCCCCATTTACATCGAAAACATACACAAGGCCAAGCATGGAAGTGATTCCGCGACTTACGACACTGAAGGAAGGTTTATTCCATCGAACCTCGAGAATATTTTCAGCAAATACGGCCGCACGGTTCCAGATAAACTCACGTTCAAGGAGCTTTGGCATATGACTGATGCCACTCGCAATGCCTTTGATTTTTTTGG...

Protein

Download Protein FASTA

138 aa · TkA05G450100|TK1151|PROTEIN

MVYAHLAMSYVTLPTWLPSPFFPIYIENIHKAKHGSDSATYDTEGRFIPSNLENIFSKYGRTVPDKLTFKELWHMTDATRNAFDFFGWIAGKFEWLALYLLAKDSEGFLSKESVRRCFDGSLFEYCAKMQRGDAGKKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G450100`
TK1151 ID	TkA05G450100
OH-1004 ID	LXL04_022197
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 57.983 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G450100

Location Chr05:112530935-112532549 (+)

Description Similar to PXG3: Probable peroxygenase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26740`	Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies.	No verified direct reference in this release
`At5g55240`	Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies.	No verified direct reference in this release
`At2g33380`	Probable calcium-binding peroxygenase.	RD20, a stress-inducible caleosin, participates in stomatal control, transpiration and drought tolerance in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq155

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022197 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009269 response to desiccation Biological Process

GO:0009409 response to cold Biological Process

GO:0009620 response to fungus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010431 seed maturation Biological Process

GO:0010888 negative regulation of lipid storage Biological Process

GO:0031407 oxylipin metabolic process Biological Process

KEGG gene cross-reference

ath:AT2G33380

ath:AT4G26740

ath:AT5G55240

dosa:Os04g0511200

sind:105171741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.523

Rank 1 · TkA05G450100 · TK1151

Mitochondrion0.228

Rank 2 · TkA05G450100 · TK1151

Cytoplasm0.154

Rank 3 · TkA05G450100 · TK1151

Nucleus0.104

Rank 4 · TkA05G450100 · TK1151

Extracellular0.087

Rank 5 · TkA05G450100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05042Caleosin2-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G450100	`PF05042`	Caleosin	2	126	4.6e-54	183.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81270`	Arabidopsis thaliana	sp\|O81270\|PXG1_ARATH Peroxygenase 1	72.700%	Swiss-Prot	High
`Q9FLN9`	Arabidopsis thaliana	sp\|Q9FLN9\|PXG2_ARATH Peroxygenase 2	73.400%	Swiss-Prot	High
`O22788`	Arabidopsis thaliana	sp\|O22788\|PXG3_ARATH Probable peroxygenase 3	66.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card