TkA05G449410 | RubberDandelionOmics

Gene overview

TkA05G449410

Reference: TK1151 Chr: Chr05 Coordinates: 112371693-112373598 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

695 bp · TkA05G449410|TK1151|cDNA

GACAAGTGTCACAAATTATCCTGATTTATTAGGTAGGATTTCGGTATATGTTGTTTTGCCGGTCCAATGGTCCAAGTCCAACCATCGTCGGTCTACGAGTTCAAAAAACCGTCAAGAACCCGATACGCCAAAGTGCCAAACGAACGCCGAAAATGGGTTCCATCTCTGACCATCACACCAGCTTACTTGCTCCTCGTTCTTATTCATTATCACAACCGAATCCCTTCCACCCTCGATTCATCAACTTCCCAAAAATCCCA...

CDS

Download CDS FASTA

1029 bp · TkA05G449410|TK1151|CDS

ATGTTGTTTTGCCGGTCCAATGGTCCAAGTCCAACCATCGTCGGTCTACGAGTTCAAAAAACCGTCAAGAACCCGATACGCCAAAGTGCCAAACGAACGCCGAAAATGGGTTCCATCTCTGACCATCACACCAGCTTACTTGCTCCTCGTTCTTATTCATTATCACAACCGAATCCCTTCCACCCTCGATTCATCAACTTCCCAAAAATCCCATTTTGTAATTCATACCCTTTACTATCGTCATCCCTTATAAACCTTAT...

Protein

Download Protein FASTA

342 aa · TkA05G449410|TK1151|PROTEIN

MLFCRSNGPSPTIVGLRVQKTVKNPIRQSAKRTPKMGSISDHHTSLLAPRSYSLSQPNPFHPRFINFPKIPFCNSYPLLSSSLINLIANRTPRSVVTAKKKTPSSEPVLSPSVVEEVSEDDDFEEFDDEEFADDDDIDADYLLEDAEPRAGDGSGGGGISLAGTKWDEQVLAIAEQVLMSFNGELGIYAFRTFQHSAIRVRIERLTNKSGSPTMEDIEVFAKAYRERLNEAEAAGSIPDNISIEVSSPGLERVVRVPDDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G449410`
TK1151 ID	TkA05G449410
OH-1004 ID	LXL04_022185
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G449410`
Location	Chr05:112371693-112373598 (+)
Description	Similar to rimP: Ribosome maturation factor RimP (Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022185` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000028 ribosomal small subunit assembly Biological Process GO:0006412 translation Biological Process GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	lbf:LBF_1470 lbi:LEPBI_I1523 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.966

Rank 1 · TkA05G449410 · TK1151

Nucleus0.046

Rank 2 · TkA05G449410 · TK1151

Mitochondrion0.036

Rank 3 · TkA05G449410 · TK1151

Cytoplasm0.029

Rank 4 · TkA05G449410 · TK1151

Peroxisome0.014

Rank 5 · TkA05G449410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02576RimP_N133-144 aa

PF02576RimP_N189-251 aa

PF25498DUF7912253-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G449410	`PF02576`	RimP_N	133	144	0.00055	21.0
TkA05G449410	`PF02576`	RimP_N	189	251	0.00055	21.0
TkA05G449410	`PF25498`	DUF7912	253	339	2.8e-37	127.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card