TkA05G449040 | RubberDandelionOmics

Gene overview

TkA05G449040

Reference: TK1151 Chr: Chr05 Coordinates: 112256552-112257891 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · TkA05G449040|TK1151|cDNA

AAAACCATCTCTCCATCTCTCCAGTTTCCGAGTTTTCTCCGTTCGACTCTCCTGGTCTCCGTCTCTTGCTCTCTATCGGCGACTCCAAACCTCCAACTCCACTGCCGGCGTCTCACTGGCCCTGGTCCACTGGTCGCACTTCATCTCCAACACACTTCGTCTCCGCCGGTCTCATCTCTCCAGTTTCCGACTTTTCTCCGATCGACTCTCCTGGTCTCCGTCTCTTGCTCTCTATCGGCGACTCCAAGGCTCCAACTCCG...

CDS

Download CDS FASTA

354 bp · TkA05G449040|TK1151|CDS

AAAACCATCTCTCCATCTCTCCAGTTTCCGAGTTTTCTCCGTTCGACTCTCCTGGTCTCCGTCTCTTGCTCTCTATCGGCGACTCCAAACCTCCAACTCCACTGCCGGCGTCTCACTGGCCCTGGTCCACTGGTCGCACTTCATCTCCAACACACTTCGTCTCCGCCGGTCTCATCTCTCCAGTTTCCGACTTTTCTCCGATCGACTCTCCTGGTCTCCGTCTCTTGCTCTCTATCGGCGACTCCAAGGCTCCAACTCCG...

Protein

Download Protein FASTA

117 aa · TkA05G449040|TK1151|PROTEIN

KTISPSLQFPSFLRSTLLVSVSCSLSATPNLQLHCRRLTGPGPLVALHLQHTSSPPVSSLQFPTFLRSTLLVSVSCSLSATPRLQLRCWRRTGPWSTSRTSSPTHFVSAGRITSSLD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G449040`
TK1151 ID	TkA05G449040
OH-1004 ID	LXL04_037768
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.400
Protein coverage (%)	TK1151 97.436 / OH-1004 40.994 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G449040`
Location	Chr05:112256552-112257891 (+)
Description	Similar to EMF2: Polycomb group protein EMBRYONIC FLOWER 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037768` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006325 chromatin organization Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0009908 flower development Biological Process GO:0009910 negative regulation of flower development Biological Process GO:0030154 cell differentiation Biological Process GO:0031507 heterochromatin formation Biological Process GO:0048586 regulation of long-day photoperiodism, flowering Biological Process GO:0141044 epigenetic programming in the endosperm Biological Process GO:0005634 nucleus Cellular Component GO:0005677 chromatin silencing complex Cellular Component GO:0031519 PcG protein complex Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function
KEGG gene cross-reference	ath:AT5G51230 dosa:Os04g0162100 dosa:Os09g0306800 osa:4335036 osa:4346674 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.539

Rank 1 · TkA05G449040 · TK1151

Cytoplasm0.451

Rank 2 · TkA05G449040 · TK1151

Mitochondrion0.065

Rank 3 · TkA05G449040 · TK1151

Cell membrane0.061

Rank 4 · TkA05G449040 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA05G449040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28680Brambleberry_hb7-33 aa

PF28680Brambleberry_hb60-80 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G449040	`PF28680`	Brambleberry_hb	7	33	0.0034	18.0
TkA05G449040	`PF28680`	Brambleberry_hb	60	80	0.0034	18.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card