TkA05G446200 | RubberDandelionOmics

Gene overview

TkA05G446200

Reference: TK1151 Chr: Chr05 Coordinates: 111593968-111594680 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

438 bp · TkA05G446200|TK1151|cDNA

ATGGAGCGGAACTCCTCAACACCAAATTGGGTACTGTCAGCTGTCACCGAGAAAGTCCCAATGGCCGGAGGAAAAACTAGGTCCAAAACCGCCGCCGTATTTCAACGCCGGAATGTTTATAACTATACCTTGTTGATGCTATGGCGCCACCCGGAAAACGTGGAACTGGGGAAGGTCAAGGTGGTGCACTATACCTGCGCCGGCGAGGCAAAGCCGTGGAGGGTCACCGGCACGGAGGAGATTATGGATAGGAAAGAAGT...

CDS

Download CDS FASTA

438 bp · TkA05G446200|TK1151|CDS

ATGGAGCGGAACTCCTCAACACCAAATTGGGTACTGTCAGCTGTCACCGAGAAAGTCCCAATGGCCGGAGGAAAAACTAGGTCCAAAACCGCCGCCGTATTTCAACGCCGGAATGTTTATAACTATACCTTGTTGATGCTATGGCGCCACCCGGAAAACGTGGAACTGGGGAAGGTCAAGGTGGTGCACTATACCTGCGCCGGCGAGGCAAAGCCGTGGAGGGTCACCGGCACGGAGGAGATTATGGATAGGAAAGAAGT...

Protein

Download Protein FASTA

145 aa · TkA05G446200|TK1151|PROTEIN

MERNSSTPNWVLSAVTEKVPMAGGKTRSKTAAVFQRRNVYNYTLLMLWRHPENVELGKVKVVHYTCAGEAKPWRVTGTEEIMDRKEVKMLVDKWWDIYDDVDLDYQHVRDKSFTIPAVTAVNSKPPRVDTVRCAAKFHNGVVLGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G446200`
TK1151 ID	TkA05G446200
OH-1004 ID	LXL04_022116
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 67.586 / OH-1004 21.973 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G446200

Location Chr05:111593968-111594680 (+)

Description Similar to GOLS2: Galactinol synthase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47180`	Galactinol synthase involved in the biosynthesis of raffinose family oligosaccharides (RFOs) that function as osmoprotectants.	Galactinol synthase1. A novel heat shock factor target gene responsible for heat-induced synthesis of raffinose family oligosaccharides in Arabidopsis.2004 · DOI: 10.1104/pp.104.042606 Galactinol and raffinose constitute a novel function to protect plants from oxidative damage.2008 · DOI: 10.1104/pp.108.122465
`At1g56600`	Galactinol synthase involved in the biosynthesis of raffinose family oligosaccharides (RFOs) that function as osmoprotectants.	Important roles of drought- and cold-inducible genes for galactinol synthase in stress tolerance in Arabidopsis thaliana.2002 · DOI: 10.1046/j.0960-7412.2001.01227.x Galactinol and raffinose constitute a novel function to protect plants from oxidative damage.2008 · DOI: 10.1104/pp.108.122465
`At1g60470`	Galactinol synthase involved in the biosynthesis of raffinose family oligosaccharides (RFOs) that function as osmoprotectants.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022116 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006012 galactose metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G09350

ath:AT1G56600

ath:AT2G47180

ath:AT5G30500

sly:100316891

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.292

Rank 1 · TkA05G446200 · TK1151

Cytoplasm0.241

Rank 2 · TkA05G446200 · TK1151

Nucleus0.240

Rank 3 · TkA05G446200 · TK1151

Plastid0.159

Rank 4 · TkA05G446200 · TK1151

Cell membrane0.055

Rank 5 · TkA05G446200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25590DUF79369-19 aa

PF01501Glyco_transf_838-74 aa

PF25590DUF793640-70 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G446200	`PF25590`	DUF7936	9	19	0.042	15.3
TkA05G446200	`PF01501`	Glyco_transf_8	38	74	0.0055	17.0
TkA05G446200	`PF25590`	DUF7936	40	70	0.042	15.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22893`	Arabidopsis thaliana	sp\|O22893\|GOLS1_ARATH Galactinol synthase 1	62.900%	Swiss-Prot	Medium
`Q9FXB2`	Arabidopsis thaliana	sp\|Q9FXB2\|GOLS2_ARATH Galactinol synthase 2	70.000%	Swiss-Prot	Low
`O22693`	Arabidopsis thaliana	sp\|O22693\|GOLS4_ARATH Galactinol synthase 4	69.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card