TkA05G445200 | RubberDandelionOmics

Gene overview

TkA05G445200

Reference: TK1151 Chr: Chr05 Coordinates: 111351132-111362202 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1758 bp · TkA05G445200|TK1151|cDNA

AGCTGATCCACCTTCGCAGTTACGATGACATCCACTGGAAACTGCAATTACTCATGCGCTACTGCTACTGAAACCCTAGAATGGATTCACGCCATTATAGACCATATGAACCCGTATAGCTTTTTCTGGGAATCTCATGTCGTCAATTTCCTGACGCATAGACTGTGGGAAGCTGTTGATAAAGAATGGCTTGATTGCTTGCGGGATGAACCAGTCGAGCATCTTATTCAAATTCCTTCTGGCTTTTGTCAGGACCACTG...

CDS

Download CDS FASTA

4545 bp · TkA05G445200|TK1151|CDS

ATGGGCCAGAACTCGCCCAGTACAAACGACGGTGACAACTCAAATGCCAACTCCGACGGCACCGGATTATACCCGATCCGGGTCGCTTCCCATTCAAGAGAAACCCTAAACCTGCGTCTATACCTTTATCGAAATCATCTGCTGCAGTCAGCTTATCGGATCGGCGCCGATCTCACGTCCATGGAGGCCGATCCGTTGTTCCTCGGAAGCTGTGCTCAGTCAGGGGGACGTCGTTGTTTTACCTGTGGTGGTGGTGAGAG...

Protein

Download Protein FASTA

1514 aa · TkA05G445200|TK1151|PROTEIN

MGQNSPSTNDGDNSNANSDGTGLYPIRVASHSRETLNLRLYLYRNHLLQSAYRIGADLTSMEADPLFLGSCAQSGGRRCFTCGGGERIGRTVREGLKFGSSLKFISSRIDRSFELERARDKPRVGVRSPRLAIILGNMEDDPLSLMLLTVMKNLQGLGYVLQIYATEDGKTKSLWEKTVGQVSVLSPENYGHIDWSIFDGIVVNSLEAHDAILSLMQEPFCSVQLIWIIQEDTLSNRLPLYQQTGQQHLITYWKKVFRRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G445200`
TK1151 ID	TkA05G445200
OH-1004 ID	LXL04_022103
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	90.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G445200`
Location	Chr05:111351132-111362202 (-)
Description	Similar to Rrnad1: Protein RRNAD1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022103` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0032259 methylation Biological Process GO:0016020 membrane Cellular Component GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity Molecular Function GO:0008168 methyltransferase activity Molecular Function
KEGG gene cross-reference	bta:532204 hsa:51093 mmu:216292 mmu:229503 rno:361976 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.241

Rank 1 · TkA05G445200 · TK1151

Nucleus0.198

Rank 2 · TkA05G445200 · TK1151

Endoplasmic reticulum0.169

Rank 3 · TkA05G445200 · TK1151

Golgi apparatus0.139

Rank 4 · TkA05G445200 · TK1151

Cell membrane0.128

Rank 5 · TkA05G445200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00534Glycos_transf_1363-478 aa

PF13692Glyco_trans_1_4363-472 aa

PF13489Methyltransf_231005-1052 aa

PF13679Methyltransf_321152-1305 aa

PF13692Glyco_trans_1_41153-1180 aa

PF13489Methyltransf_231157-1216 aa

PF05175MTS1167-1206 aa

PF05206TRM131172-1300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G445200	`PF00534`	Glycos_transf_1	363	478	4.9e-14	52.9
TkA05G445200	`PF13692`	Glyco_trans_1_4	363	472	4.5e-09	37.4
TkA05G445200	`PF13489`	Methyltransf_23	1005	1052	0.0011	19.4
TkA05G445200	`PF13679`	Methyltransf_32	1152	1305	1.2e-30	107.1
TkA05G445200	`PF13692`	Glyco_trans_1_4	1153	1180	4.5e-09	37.4
TkA05G445200	`PF13489`	Methyltransf_23	1157	1216	0.0011	19.4
TkA05G445200	`PF05175`	MTS	1167	1206	0.31	11.3
TkA05G445200	`PF05206`	TRM13	1172	1300	0.0014	18.9
TkA05G445200	`PF13649`	Methyltransf_25	1176	1217	0.012	17.0
TkA05G445200	`PF13649`	Methyltransf_25	1247	1313	0.012	17.0
TkA05G445200	`PF05206`	TRM13	1463	1508	0.0014	18.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card