Gene Card
Gene overview
cDNA / CDS / Protein Sequences
747 bp · TkA05G444200|TK1151|cDNA
ATGGTTTCTGATCGGAGCACTAGTTCTGATTCTCACAGGTCAGCGACTTCCTTCTTCTGGGATCACCAGTCACTTCTTTCCGCCGCTTCCGGCACAATCCACGACTCCGGCGGCACCAAGCTTCTGCGTGGCATCCCCTACTACATACTCCCCCTCCTCCGTAGCTCCGGCGGTGGACTAACCCTTACCCGGAACACAAAAGACGCATGTCCACTCAACGTCACCCAAGAGTCCTTCGAGGTCAACTATGGAAGTCCGTT...
747 bp · TkA05G444200|TK1151|CDS
ATGGTTTCTGATCGGAGCACTAGTTCTGATTCTCACAGGTCAGCGACTTCCTTCTTCTGGGATCACCAGTCACTTCTTTCCGCCGCTTCCGGCACAATCCACGACTCCGGCGGCACCAAGCTTCTGCGTGGCATCCCCTACTACATACTCCCCCTCCTCCGTAGCTCCGGCGGTGGACTAACCCTTACCCGGAACACAAAAGACGCATGTCCACTCAACGTCACCCAAGAGTCCTTCGAGGTCAACTATGGAAGTCCGTT...
Protein
Download Protein FASTA248 aa · TkA05G444200|TK1151|PROTEIN
MVSDRSTSSDSHRSATSFFWDHQSLLSAASGTIHDSGGTKLLRGIPYYILPLLRSSGGGLTLTRNTKDACPLNVTQESFEVNYGSPFTFTPIVLDEEIIRGAYPVSIEADVTNPCHGSNIWKVTTAAAAKDDDNDELLTNNKDKKKKEDDKGVPVHSVTTGGEFNKPESCFQIVEDDVMPGLRSYQIQHCPFKCGSQSTDLACYNVGIVRDADGKGYLGRTDAIYPVVFMNCLGTFSQSVKISRLSAE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G444200 |
|---|---|
| TK1151 ID | TkA05G444200 |
| OH-1004 ID | LXL04_022090 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.700 |
| Protein coverage (%) | TK1151 92.742 / OH-1004 94.262Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G444200 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:111071429-111073458 (-) | |||||||||
| Description | Similar to Miraculin | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0002237 response to molecule of bacterial origin Biological Process GO:0002238 response to molecule of fungal origin Biological Process GO:0006952 defense response Biological Process GO:0009611 response to wounding Biological Process GO:0009624 response to nematode Biological Process GO:0009625 response to insect Biological Process GO:0009751 response to salicylic acid Biological Process GO:0010466 negative regulation of peptidase activity Biological Process GO:0012501 programmed cell death Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0042742 defense response to bacterium Biological Process GO:0005576 extracellular region Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G17860 ath:AT1G73260 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00197Kunitz_legume34-230 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G444200 | PF00197 | Kunitz_legume | 34 | 230 | 1.3e-29 | 104.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.