TkA05G442210 | RubberDandelionOmics

Gene overview

TkA05G442210

Reference: TK1151 Chr: Chr05 Coordinates: 110416300-110422138 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3096 bp · TkA05G442210|TK1151|cDNA

CACTCATCCAATCGCATGGCGTCACAATCTGACTAAAAGTCAAACTGCTTAGCTACAAGAAACCATAAAACCTTTTACAAACAATTTCTCCAAAGCTCCCATCTTTTTCCCAATTCTCTCATCAAACAAGATAAATCTCTCCCATGGTCTATGACTAGTTCTCGCACAAATCCATTCCTCCAAGTCGCGCTATCTGCAGAGATTCCAACGCCAAAAAGGTGTTCGATCGATTTCCAGATTGTACACAATGAGAAACCGGT...

CDS

Download CDS FASTA

1548 bp · TkA05G442210|TK1151|CDS

ATGAGAAACCGGTCAAAAAAGTCTACGGCTACATCAAACGAAACCAGCGATGGGGTGAAGCCAGTAGACCAAATAAACATCAAGAATGTAGTGACAGCAACGAGATCACCTTACGCTATTCTCGCTCTGTTTATCTTAGTCACACAAGGGATATGGGCAGTTCATCATTACCAATTCGAAACTCTCCCGGAGCCACTTACCGCCGACCAGGTAGGGAAACGAGGGTTTTCGGAAGAACAGGCAATGAAGCACGTCAAAGC...

Protein

Download Protein FASTA

515 aa · TkA05G442210|TK1151|PROTEIN

MRNRSKKSTATSNETSDGVKPVDQINIKNVVTATRSPYAILALFILVTQGIWAVHHYQFETLPEPLTADQVGKRGFSEEQAMKHVKALTQLGPHPVGSDALELGLQYVLDAAEKIKSTAHWEVDVDVDLFHATSGANILVGGLFKGKTLVYSDLKHVVLRISPKYTSHEEEEEDSAILVSSHIDTVFSSEGAGDCSSCVAVMLELARGISQWAHGFKNSVIFLFNTGEEEGLNGAHSFITQHPWSSSIQMAIDLEAMGIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G442210`
TK1151 ID	TkA05G442210
OH-1004 ID	LXL04_022040
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.300
Protein coverage (%)	TK1151 99.029 / OH-1004 59.116 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G442210`
Location	Chr05:110416300-110422138 (+)
Description	Similar to Ermp1: Endoplasmic reticulum metallopeptidase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022040` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0030968 endoplasmic reticulum unfolded protein response Biological Process GO:0034599 cellular response to oxidative stress Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0008235 metalloexopeptidase activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	cel:CELE_B0495.7 hsa:79956 mmu:226090 rno:373544 xla:398673 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.723

Rank 1 · TkA05G442210 · TK1151

Golgi apparatus0.120

Rank 2 · TkA05G442210 · TK1151

Nucleus0.094

Rank 3 · TkA05G442210 · TK1151

Cytoplasm0.093

Rank 4 · TkA05G442210 · TK1151

Lysosome / Vacuole0.067

Rank 5 · TkA05G442210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04389Peptidase_M28170-299 aa

PF05343Peptidase_M42170-186 aa

PF01546Peptidase_M20179-241 aa

PF05343Peptidase_M42197-257 aa

PF04389Peptidase_M28298-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G442210	`PF04389`	Peptidase_M28	170	299	1.1e-36	127.1
TkA05G442210	`PF05343`	Peptidase_M42	170	186	0.011	15.5
TkA05G442210	`PF01546`	Peptidase_M20	179	241	0.0053	17.4
TkA05G442210	`PF05343`	Peptidase_M42	197	257	0.011	15.5
TkA05G442210	`PF04389`	Peptidase_M28	298	328	1.1e-36	127.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card