TkA05G438880 | RubberDandelionOmics

Gene overview

TkA05G438880

Reference: TK1151 Chr: Chr05 Coordinates: 109599240-109600527 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1220 bp · TkA05G438880|TK1151|cDNA

CTCAAAACAATATTTTCTGGAAACCACAAGAATCAATACCGAAATTTTGTCAAGTTAATATATACTTCTCGAATAAACATTTAATACCGTAGCATTAAACTTTAAAAAAAACAAAGAAAAAAAAAGAAAAACAATGATACGGTTTTCTCGTTTCCCAAAGAAAAACAATACCTATTCTACCCCCATTCAACCCCCTCTATATATTCCCGCCTCCCTCTTTCCACCACCTAAAGCCACCTCGATCCCCATCACCCTTTTAA...

CDS

Download CDS FASTA

615 bp · TkA05G438880|TK1151|CDS

ATGGAGGCCCGCCTGAATACCTCCATCGCCGCCGCCGCCGCCAAACCCATGAACATTTCCACACCGACAGAAGAATCCGATTACTCCTACTCCTACTCCTACTCCCAGTCCCCTCCATCGTCTCCCCCGGTGGTCCTCAGCCCCTGTGCCGCCTGCAAGATTCTCCGACGCCGGTGCATCGACAAATGCATGCTGGCACCCTACTTCCCTCCCACCGACCCCCACAAGTTCACCATTGCGCATAGAGTCTTCGGTGCCAG...

Protein

Download Protein FASTA

204 aa · TkA05G438880|TK1151|PROTEIN

MEARLNTSIAAAAAKPMNISTPTEESDYSYSYSYSQSPPSSPPVVLSPCAACKILRRRCIDKCMLAPYFPPTDPHKFTIAHRVFGASNIIKLLQELPECRRADAVSSMVYEANARLRDPVYGCAGTICQLQKQLSALQAELAKTQAEVVNLQCRQSNFLTIIRMQMDQRPETSVSPPQHTQLPYESAGFFEDNVNLGSFEPLWT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G438880`
TK1151 ID	TkA05G438880
OH-1004 ID	LXL04_022008
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 82.843 / OH-1004 41.220 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G438880

Location Chr05:109599240-109600527 (+)

Description Similar to LBD1: LOB domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28500`	LOB domain-containing protein 11.	No verified direct reference in this release
`At1g07900`	LOB domain-containing protein 1.	No verified direct reference in this release
`At1g31320`	LOB domain-containing protein 4.	No verified direct reference in this release
`At2g30130`	LOB domain-containing protein 12.	No verified direct reference in this release
`At2g40470`	LOB domain-containing protein 15.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022008 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:0048364 root development Biological Process

GO:0080117 secondary growth Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G07900

ath:AT1G16530

ath:AT2G28500

ath:AT2G30130

ath:AT3G18110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.957

Rank 1 · TkA05G438880 · TK1151

Cytoplasm0.106

Rank 2 · TkA05G438880 · TK1151

Cell membrane0.027

Rank 3 · TkA05G438880 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA05G438880 · TK1151

Plastid0.014

Rank 5 · TkA05G438880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195LOB48-145 aa

PF25610HR1_TOCA108-152 aa

PF06818Fez1124-158 aa

PF28743IPGAL2_N127-152 aa

PF08227DASH_Hsk3129-159 aa

PF14282FlxA129-148 aa

PF14282FlxA161-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G438880	`PF03195`	LOB	48	145	1.5e-40	138.5
TkA05G438880	`PF25610`	HR1_TOCA	108	152	0.2	12.7
TkA05G438880	`PF06818`	Fez1	124	158	0.17	13.0
TkA05G438880	`PF28743`	IPGAL2_N	127	152	0.039	14.4
TkA05G438880	`PF08227`	DASH_Hsk3	129	159	0.18	13.0
TkA05G438880	`PF14282`	FlxA	129	148	3.9	8.5
TkA05G438880	`PF14282`	FlxA	161	195	3.9	8.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SK08`	Arabidopsis thaliana	sp\|Q9SK08\|LBD11_ARATH LOB domain-containing protein 11	55.100%	Swiss-Prot	High
`Q9LQR0`	Arabidopsis thaliana	sp\|Q9LQR0\|LBD1_ARATH LOB domain-containing protein 1	60.700%	Swiss-Prot	High
`Q9SHE9`	Arabidopsis thaliana	sp\|Q9SHE9\|LBD4_ARATH LOB domain-containing protein 4	50.900%	Swiss-Prot	High
`Q8LBW3`	Arabidopsis thaliana	sp\|Q8LBW3\|LBD12_ARATH LOB domain-containing protein 12	59.300%	Swiss-Prot	Medium
`Q8L5T5`	Arabidopsis thaliana	sp\|Q8L5T5\|LBD15_ARATH LOB domain-containing protein 15	53.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card