TkA05G438490 | RubberDandelionOmics

Gene overview

TkA05G438490

Reference: TK1151 Chr: Chr05 Coordinates: 109473809-109478610 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3442 bp · TkA05G438490|TK1151|cDNA

TTTATATTAACACAAAAACTAGGTTCGTTCCCATCTCCCAAATCGTAGGTTCACCCCAGCCCCCAACTCGCCAAATCCCCGATTTGAAACCCTGCGAAAACCGTCGATAAGACGATAGGCTTCTTTCTTCAACCTTGGAACGGTGGAATATGGAAAACCCTAAATCGCAATTGTTGGATATTTGAAACGCAGAACTCGAAGCTCACTCTCACATTGAACCCTAAATCGTTAAGGAAGAGGACGCAAGGAAGATTTGTGTT...

CDS

Download CDS FASTA

2781 bp · TkA05G438490|TK1151|CDS

ATGGAGCGACAAAGGGACAGAATGGTAGATATGGTCAATGATGAAGATGATAAACATAGAAGAAGAAGAGATGGTGATAGATATAGGAGCGAACGAGATAGTCAAGATAGGAGGATCAACAACAAGAGCGATGAAGAAAGGGGTAGAGATAGGAACAAGGAAATTGTTAAAGATAGGAGAGATAGATACAGGAGTGATGATGAAGATGCAAATGATAGGAGGAGGAGAAGAGATAGGGATGGTGATAGAAGGCGTGGTGA...

Protein

Download Protein FASTA

926 aa · TkA05G438490|TK1151|PROTEIN

MERQRDRMVDMVNDEDDKHRRRRDGDRYRSERDSQDRRINNKSDEERGRDRNKEIVKDRRDRYRSDDEDANDRRRRRDRDGDRRRGDDYGNERRRTRNSEDKNDKVRDKKEDKGTDNEDDNDRRKKERDEDTRRRVRSDDDEANDRNNRKKKEDMKRSDEIDQSDEEAGEIRKSGKKNDERSDSEDGEIRKSGRKGSKHDDTSDKETGEIKKRGRKGNKYDDTSDKETGEIKKRGRKGKDTRSDDDDDDDDEDDHKDRRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G438490`
TK1151 ID	TkA05G438490
OH-1004 ID	LXL04_022002
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.220 / OH-1004 96.220 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G438490`
Location	Chr05:109473809-109478610 (-)
Description	Similar to Cwc22: Pre-mRNA-splicing factor CWC22 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022002` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005829 cytosol Cellular Component GO:0016607 nuclear speck Cellular Component GO:0071005 U2-type precatalytic spliceosome Cellular Component GO:0071006 U2-type catalytic step 1 spliceosome Cellular Component GO:0071007 U2-type catalytic step 2 spliceosome Cellular Component GO:0071013 catalytic step 2 spliceosome Cellular Component GO:0071018 U12-type catalytic step 2 spliceosome Cellular Component
KEGG gene cross-reference	hsa:57703 mmu:80744 xla:734468 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.931

Rank 1 · TkA05G438490 · TK1151

Cytoplasm0.144

Rank 2 · TkA05G438490 · TK1151

Cell membrane0.026

Rank 3 · TkA05G438490 · TK1151

Mitochondrion0.014

Rank 4 · TkA05G438490 · TK1151

Extracellular0.013

Rank 5 · TkA05G438490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02854MIF4G392-573 aa

PF02847MA3682-788 aa

PF02854MIF4G743-766 aa

PF02854MIF4G813-887 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G438490	`PF02854`	MIF4G	392	573	1.9e-17	64.4
TkA05G438490	`PF02847`	MA3	682	788	6.2e-31	107.4
TkA05G438490	`PF02854`	MIF4G	743	766	1.9e-17	64.4
TkA05G438490	`PF02854`	MIF4G	813	887	1.9e-17	64.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card