TkA05G430620 | RubberDandelionOmics

Gene overview

TkA05G430620

Reference: TK1151 Chr: Chr05 Coordinates: 107399651-107402741 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2907 bp · TkA05G430620|TK1151|cDNA

CTTTGAATATTTTTTTCAATTACTTATGAGGATTTCTATGCTCCATTAACAAATGTTTATTTTCCATCATATCCTTCATAACACTCATTATAGATGACCATGATCATCAATGCCATTTTTCATATTTTTATCCCTATTTTGACTAATTTTATTTATACAGAATAAAAACGTTACAGACCAAACCTGTACGTTGAGAATAAGTTGAAGGACTATATATGTAACTTACTGATCTCATTTCACCGAAAAAGGTATTGGTCAAA...

CDS

Download CDS FASTA

2334 bp · TkA05G430620|TK1151|CDS

ATGACGACACGCTTGATCACCGTCATTTTCGTTGCGGTGGTTATATCATCAGTCATCTCGTTAGTCAATGCGCTCGGTGGCTCCGCTACCACCGTCTCTGTAAGCTACGGCGCGACTCCCACCGTCTGTGGTATAGTCGCTGGTCAACCGAGTCAACGAATTCAATGTTGGCGCAACGGGACGGTATTCAACGCTTTTTATAACATCTCATTCGAGTCCGTCGCCGGAGGTCGTGATGTGTTCTGCGGCGTAAGGTCCGG...

Protein

Download Protein FASTA

777 aa · TkA05G430620|TK1151|PROTEIN

MTTRLITVIFVAVVISSVISLVNALGGSATTVSVSYGATPTVCGIVAGQPSQRIQCWRNGTVFNAFYNISFESVAGGRDVFCGVRSGGSTLVCWDDSLVPKRIYYNETVLLRHLTIGDSQICAITSSSDQNVDCWRSNGAFPSQNRQLRSISSGFGFTCGVTQNTSEVICFGANSASASIIQGTFTNFRLLNIAVGGNHACGVNATGFLICRGNNDQNQTNVPDHLPFEFSALALGANHTCALRRLNNSVVCWGGGGGAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G430620`
TK1151 ID	TkA05G430620
OH-1004 ID	LXL04_021856
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G430620

Location Chr05:107399651-107402741 (-)

Description Similar to CCR3: Putative serine/threonine-protein kinase-like protein CCR3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55950`	Serine/threonine-protein kinase.	No verified direct reference in this release
`At5g47850`	Serine/threonine-protein kinase-like protein CCR4.	No verified direct reference in this release
`At3g59420`	Controls formative cell division in meristems, including root tips and lateral root initiation zones of the pericycle, in response to CLE40 signal.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0637800`	Receptor protein kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021856 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009786 regulation of asymmetric cell division Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010311 lateral root formation Biological Process

GO:0032877 positive regulation of DNA endoreduplication Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0048439 flower morphogenesis Biological Process

GO:0048829 root cap development Biological Process

GO:0080136 priming of cellular response to stress Biological Process

GO:0090392 sepal giant cell differentiation Biological Process

GO:0090627 plant epidermal cell differentiation Biological Process

GO:0099402 plant organ development Biological Process

KEGG gene cross-reference

ath:AT3G55950

ath:AT3G59420

ath:AT5G47850

dosa:Os03g0637800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.801

Rank 1 · TkA05G430620 · TK1151

Cytoplasm0.088

Rank 2 · TkA05G430620 · TK1151

Endoplasmic reticulum0.084

Rank 3 · TkA05G430620 · TK1151

Nucleus0.056

Rank 4 · TkA05G430620 · TK1151

Lysosome / Vacuole0.039

Rank 5 · TkA05G430620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13540RCC1_273-94 aa

PF13540RCC1_2121-135 aa

PF13540RCC1_2149-175 aa

PF25390WD40_RLD187-295 aa

PF13540RCC1_2193-219 aa

PF13540RCC1_2232-255 aa

PF13540RCC1_2272-294 aa

PF00069Pkinase473-687 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G430620	`PF13540`	RCC1_2	73	94	1.3e-11	44.7
TkA05G430620	`PF13540`	RCC1_2	121	135	1.3e-11	44.7
TkA05G430620	`PF13540`	RCC1_2	149	175	1.3e-11	44.7
TkA05G430620	`PF25390`	WD40_RLD	187	295	1.5e-05	25.2
TkA05G430620	`PF13540`	RCC1_2	193	219	1.3e-11	44.7
TkA05G430620	`PF13540`	RCC1_2	232	255	1.3e-11	44.7
TkA05G430620	`PF13540`	RCC1_2	272	294	1.3e-11	44.7
TkA05G430620	`PF00069`	Pkinase	473	687	3.2e-40	138.9
TkA05G430620	`PF07714`	PK_Tyr_Ser-Thr	473	757	2.3e-39	136.0
TkA05G430620	`PF03109`	ABC1	476	501	0.00016	21.6
TkA05G430620	`PF03109`	ABC1	594	631	0.00016	21.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LY50`	Arabidopsis thaliana	sp\|Q9LY50\|ACCR3_ARATH Putative serine/threonine-protein kinase-like protein CCR3	56.300%	Swiss-Prot	High
`Q9FIJ6`	Arabidopsis thaliana	sp\|Q9FIJ6\|ACCR4_ARATH Serine/threonine-protein kinase-like protein CCR4	35.600%	Swiss-Prot	Medium
`Q9LX29`	Arabidopsis thaliana	sp\|Q9LX29\|ACR4L_ARATH Serine/threonine-protein kinase-like protein ACR4	31.600%	Swiss-Prot	Medium
`Q75J39`	Oryza sativa subsp. japonica	sp\|Q75J39\|CKI4_ORYSJ Serine/threonine-protein kinase-like protein CR4	32.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card