TkA05G430030 | RubberDandelionOmics

Gene overview

TkA05G430030

Reference: TK1151 Chr: Chr05 Coordinates: 107265062-107266497 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

674 bp · TkA05G430030|TK1151|cDNA

ACTGGGGTCAGATTGCGTGGATTTGTTGAGATGATTGAATGCTTTTAAAACCGTCTTTCTTCCCCACTTTTCCCATCTTCTTCTTCTTGTTCTTCAATCCAACCAACTTACAAAAAAAATGGGCCGATTGTTCTTGGTAACATTGGAAGGGAAGATTTACAGCTGTAAGCACTGCAAAGCCCATCTTGCTCTTTGCGACGACATTGTTTCCAAGTCCTTTCATTGTAAGCATGGAAAAGCTTATCTCTTCAGTAAGGTAG...

CDS

Download CDS FASTA

372 bp · TkA05G430030|TK1151|CDS

ATGGGCCGATTGTTCTTGGTAACATTGGAAGGGAAGATTTACAGCTGTAAGCACTGCAAAGCCCATCTTGCTCTTTGCGACGACATTGTTTCCAAGTCCTTTCATTGTAAGCATGGAAAAGCTTATCTCTTCAGTAAGGTAGTAAATGTCACAATTGGGGTTAAAGAGGATAGAATGATGATGACGGGATTACACACAGTTGCCGACATTTTCTGTGTGAAATGTGGATCGATTGTTGGATGGACATATGAAACTGCTCA...

Protein

Download Protein FASTA

123 aa · TkA05G430030|TK1151|PROTEIN

MGRLFLVTLEGKIYSCKHCKAHLALCDDIVSKSFHCKHGKAYLFSKVVNVTIGVKEDRMMMTGLHTVADIFCVKCGSIVGWTYETAHEKNQKYKEGKSVLERFKLSGPDGSSYWVGRNEQEEV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G430030`
TK1151 ID	TkA05G430030
OH-1004 ID	LXL04_021864
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G430030

Location Chr05:107265062-107266497 (-)

Description Similar to Protein yippee-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11230`	Protein yippee-like At3g11230.	No verified direct reference in this release
`At3g08990`	Protein yippee-like At3g08990.	No verified direct reference in this release
`At3g55890`	Protein yippee-like At3g55890.	No verified direct reference in this release
`At5g53940`	Protein yippee-like At5g53940.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021864 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000151 ubiquitin ligase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G08990

ath:AT3G11230

ath:AT3G55890

ath:AT5G53940

sot:102577430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.678

Rank 1 · TkA05G430030 · TK1151

Cytoplasm0.489

Rank 2 · TkA05G430030 · TK1151

Cell membrane0.051

Rank 3 · TkA05G430030 · TK1151

Mitochondrion0.045

Rank 4 · TkA05G430030 · TK1151

Endoplasmic reticulum0.042

Rank 5 · TkA05G430030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02150Zn_ribbon_RPB910-22 aa

PF25165DUF782811-40 aa

PF22289DmmA-like_C11-25 aa

PF24046At4g0833012-27 aa

PF03226Yippee-Mis1813-105 aa

PF11648RIG-I_C-RD14-85 aa

PF07191Zn_ribbon_615-45 aa

PF25122DUF781516-23 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G430030	`PF02150`	Zn_ribbon_RPB9	10	22	0.32	11.6
TkA05G430030	`PF25165`	DUF7828	11	40	0.1	13.0
TkA05G430030	`PF22289`	DmmA-like_C	11	25	0.62	10.8
TkA05G430030	`PF24046`	At4g08330	12	27	0.0065	17.2
TkA05G430030	`PF03226`	Yippee-Mis18	13	105	1.4e-12	48.4
TkA05G430030	`PF11648`	RIG-I_C-RD	14	85	0.0027	18.6
TkA05G430030	`PF07191`	Zn_ribbon_6	15	45	0.14	12.9
TkA05G430030	`PF25122`	DUF7815	16	23	4.7	7.9
TkA05G430030	`PF13917`	zf-CCHC_3	33	42	5.3	7.7
TkA05G430030	`PF25122`	DUF7815	34	42	4.7	7.9
TkA05G430030	`PF22289`	DmmA-like_C	35	39	0.62	10.8
TkA05G430030	`PF25165`	DUF7828	68	89	0.1	13.0
TkA05G430030	`PF24046`	At4g08330	69	94	0.0065	17.2
TkA05G430030	`PF13917`	zf-CCHC_3	69	86	5.3	7.7
TkA05G430030	`PF07191`	Zn_ribbon_6	70	77	0.14	12.9
TkA05G430030	`PF02150`	Zn_ribbon_RPB9	70	77	0.32	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C777`	Arabidopsis thaliana	sp\|Q9C777\|YIPL3_ARATH Protein yippee-like At3g11230	78.600%	Swiss-Prot	High
`Q9SR97`	Arabidopsis thaliana	sp\|Q9SR97\|YIPL1_ARATH Protein yippee-like At3g08990	66.400%	Swiss-Prot	High
`Q9LY56`	Arabidopsis thaliana	sp\|Q9LY56\|YIPL4_ARATH Protein yippee-like At3g55890	69.600%	Swiss-Prot	High
`Q9FN32`	Arabidopsis thaliana	sp\|Q9FN32\|YIPL7_ARATH Protein yippee-like At5g53940	62.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card