TkA05G429740 | RubberDandelionOmics

Gene overview

TkA05G429740

Reference: TK1151 Chr: Chr05 Coordinates: 107205240-107206029 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

516 bp · TkA05G429740|TK1151|cDNA

ATGCCCACCACAGCTCTGCTTCAAGCACATTATTTTAACATAAGTGGGGTCTCCACTGATGATTTCCCTGGAAATCCGGTGACACCGTATAACTATACTGGCAATGGGCCTACAAATATACAAACTAGGAGTGGGACTAAAGTTTATCGATTAGCGTATAATTCGACTGTTCAGGTTGTGATTCAAGGTAACGCGGTAATAGCACCTGAGAGCCATCCTATACATCTGCATGGGTCTAATTTTTTTGTGGTGGGAAAGGG...

CDS

Download CDS FASTA

516 bp · TkA05G429740|TK1151|CDS

ATGCCCACCACAGCTCTGCTTCAAGCACATTATTTTAACATAAGTGGGGTCTCCACTGATGATTTCCCTGGAAATCCGGTGACACCGTATAACTATACTGGCAATGGGCCTACAAATATACAAACTAGGAGTGGGACTAAAGTTTATCGATTAGCGTATAATTCGACTGTTCAGGTTGTGATTCAAGGTAACGCGGTAATAGCACCTGAGAGCCATCCTATACATCTGCATGGGTCTAATTTTTTTGTGGTGGGAAAGGG...

Protein

Download Protein FASTA

171 aa · TkA05G429740|TK1151|PROTEIN

MPTTALLQAHYFNISGVSTDDFPGNPVTPYNYTGNGPTNIQTRSGTKVYRLAYNSTVQVVIQGNAVIAPESHPIHLHGSNFFVVGKGLGNYDPMNDPKKFNLVDPVERNTLTVPTVGWIVIRFRADNPGVWFMHCHLEVHTTWGLKIAFLVDNGNGPNESIIPPPKDLPTC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G429740`
TK1151 ID	TkA05G429740
OH-1004 ID	LXL04_021867
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 71.849 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G429740

Location Chr05:107205240-107206029 (-)

Description Similar to LAC22: Laccase-22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38080`	Lignin degradation and detoxification of lignin-derived products (By similarity).	No verified direct reference in this release
`At5g01190`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release
`At5g58910`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0708100`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release
`Os01g0634500`	Lignin degradation and detoxification of lignin-derived products.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021867 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009809 lignin biosynthetic process Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0046274 lignin catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005507 copper ion binding Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0052716 hydroquinone:oxygen oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38080

ath:AT5G01190

ath:AT5G58910

osa:107276614

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.932

Rank 1 · TkA05G429740 · TK1151

Cytoplasm0.030

Rank 2 · TkA05G429740 · TK1151

Cell membrane0.021

Rank 3 · TkA05G429740 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA05G429740 · TK1151

Lysosome / Vacuole0.012

Rank 5 · TkA05G429740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07731Cu-oxidase_224-154 aa

PF22476Ago_N_336-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G429740	`PF07731`	Cu-oxidase_2	24	154	3e-41	141.1
TkA05G429740	`PF22476`	Ago_N_3	36	68	0.22	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80434`	Arabidopsis thaliana	sp\|O80434\|LAC4_ARATH Laccase-4	70.800%	Swiss-Prot	High
`Q6ID18`	Arabidopsis thaliana	sp\|Q6ID18\|LAC10_ARATH Laccase-10	68.400%	Swiss-Prot	High
`Q1PDH6`	Arabidopsis thaliana	sp\|Q1PDH6\|LAC16_ARATH Laccase-16	66.900%	Swiss-Prot	High
`Q0IQU1`	Oryza sativa subsp. japonica	sp\|Q0IQU1\|LAC22_ORYSJ Laccase-22	68.400%	Swiss-Prot	High
`Q8RYM9`	Oryza sativa subsp. japonica	sp\|Q8RYM9\|LAC2_ORYSJ Laccase-2	62.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card