RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA05G429720
Reference: TK1151 Chr: Chr05 Coordinates: 107200261-107204203 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2311 bp · TkA05G429720|TK1151|cDNA

TTACTACCTACTTTTCCTTTTTAGCAAAATAGTTAAAGGTGTCTCTCTCTATCCACTTGTCTTCCTCAATTAACATTTAACACTTTCCTTCACTCACATTCGCTCCAACTTTCTCTCTTCTTTATCATTCATGGATCTCAATAACCCCAAAATACTTCCAAAACCAGAGCTTCATCACTCTCTTCTTTGAAATTCCAATCCAATCATGGAACATCGGAGCTACAACAACCATAAGCGTCACCGCATGTCCGACGTCGTTT...

CDS

Download CDS FASTA

1782 bp · TkA05G429720|TK1151|CDS

ATGGAACATCGGAGCTACAACAACCATAAGCGTCACCGCATGTCCGACGTCGTTTTCGAATGCGTAATCCCCTACATACACGACTCCCGCGACCGGCAATCGGTCTCCCTGGTGTGCCGGAGATGGTACGAGTTAGACGCGCAGACTCGGAAGCACGTAACGATCGCGTTGTGTTACTCGTCGACGCCGATTCAGCTATGGCGGAGGTTTCCGTATCTGGAATCGTTGAAATTAAAGGGGAAACCACGCGCCGCTATGTA...

Protein

Download Protein FASTA

593 aa · TkA05G429720|TK1151|PROTEIN

MEHRSYNNHKRHRMSDVVFECVIPYIHDSRDRQSVSLVCRRWYELDAQTRKHVTIALCYSSTPIQLWRRFPYLESLKLKGKPRAAMYNLIPEDWGGFVTPWVEEFARSFRCLKAVHFRRMIVTDEDLRMLAIGRGHVLQVLKLDKCSGFSTDGLLQICRSCWNLKTLFLEESQVTEKDGEWLHELALNNTMLETLNFYMTDLSQVNFKDLELIATKCKSLISVKIGDCEILDLVGFFQAAVSLQEFSGGCFNDQAGGGGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA05G429720
TK1151 IDTkA05G429720
OH-1004 IDLXL04_021868
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.200
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA05G429720
LocationChr05:107200261-107204203 (+)
DescriptionSimilar to COI1: Coronatine-insensitive protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g39940 Required for jasmonate-regulated plant fertility and defense processes, and for coronatine and/or other elicitors perceptions/responses.
Differential gene expression in response to mechanical wounding and insect feeding in Arabidopsis.2000 · DOI: 10.1105/tpc.12.5.707
The SCF(COI1) ubiquitin-ligase complexes are required for jasmonate response in Arabidopsis.2002 · DOI: 10.1105/tpc.003368
A conditionally fertile coi1 allele indicates cross-talk between plant hormone signalling pathways in Arabidopsis thaliana seeds and young seedlings.2002 · DOI: 10.1007/s00425-002-0787-4
Arabidopsis Mutants Selected for Resistance to the Phytotoxin Coronatine Are Male Sterile, Insensitive to Methyl Jasmonate, and Resistant to a Bacterial Pathogen.1994 · DOI: 10.1105/tpc.6.5.751
COI1 links jasmonate signalling and fertility to the SCF ubiquitin-ligase complex in Arabidopsis.2002 · DOI: 10.1046/j.1365-313x.2002.01432.x
Characterization of the early response of Arabidopsis to Alternaria brassicicola infection using expression profiling.2003 · DOI: 10.1104/pp.103.022186
Activation of a COI1-dependent pathway in Arabidopsis by Pseudomonas syringae type III effectors and coronatine.2004 · DOI: 10.1111/j.1365-313x.2003.01986.x
COI1: an Arabidopsis gene required for jasmonate-regulated defense and fertility.1998 · DOI: 10.1126/science.280.5366.1091

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0449500 Involved in jasmonate (JA) signaling.
Oryza sativa COI homologues restore jasmonate signal transduction in Arabidopsis coi1-1 mutants.2013 · DOI: 10.1371/journal.pone.0052802
UniProt: A2WX30 Involved in jasmonate (JA) signaling. No verified direct reference in this release
Os01g0853400 Involved in jasmonate (JA) signaling.
OsbHLH148, a basic helix-loop-helix protein, interacts with OsJAZ proteins in a jasmonate signaling pathway leading to drought tolerance in rice.2011 · DOI: 10.1111/j.1365-313x.2010.04477.x
Plant hormone jasmonate prioritizes defense over growth by interfering with gibberellin signaling cascade.2012 · DOI: 10.1073/pnas.1201616109
silencing COI1 in rice increases susceptibility to chewing insects and impairs inducible defense.2012 · DOI: 10.1371/journal.pone.0036214
Oryza sativa COI homologues restore jasmonate signal transduction in Arabidopsis coi1-1 mutants.2013 · DOI: 10.1371/journal.pone.0052802
Priming of jasmonate-mediated antiherbivore defense responses in rice by silicon.2013 · DOI: 10.1073/pnas.1305848110
UniProt: A2XEV1 Involved in jasmonate (JA) signaling. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_021868 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002213 defense response to insect Biological Process
GO:0006511 ubiquitin-dependent protein catabolic process Biological Process
GO:0006952 defense response Biological Process
GO:0009611 response to wounding Biological Process
GO:0009625 response to insect Biological Process
GO:0009641 shade avoidance Biological Process
GO:0009753 response to jasmonic acid Biological Process
GO:0009861 jasmonic acid and ethylene-dependent systemic resistance Biological Process
GO:0009867 jasmonic acid mediated signaling pathway Biological Process
GO:0009901 anther dehiscence Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0010118 stomatal movement Biological Process
KEGG gene cross-reference
ath:AT2G39940
dosa:Os01g0853400
dosa:Os03g0265500
dosa:Os05g0449500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.771
Rank 1 · TkA05G429720 · TK1151
Cytoplasm0.159
Rank 2 · TkA05G429720 · TK1151
Plastid0.061
Rank 3 · TkA05G429720 · TK1151
Cell membrane0.051
Rank 4 · TkA05G429720 · TK1151
Endoplasmic reticulum0.026
Rank 5 · TkA05G429720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18511F-box_513-52 aa
PF12937F-box-like25-45 aa
PF12937F-box-like63-70 aa
PF24758LRR_At5g5637064-77 aa
PF18791Transp_inhibit71-117 aa
PF24758LRR_At5g56370107-191 aa
PF29594LRR_SKP2129-232 aa
PF25372LRR_FBXL15136-216 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA05G429720PF18511F-box_513523.3e-2175.3
TkA05G429720PF12937F-box-like25450.006616.9
TkA05G429720PF12937F-box-like63700.006616.9
TkA05G429720PF24758LRR_At5g5637064778.5e-0626.3
TkA05G429720PF18791Transp_inhibit711177.6e-2483.7
TkA05G429720PF24758LRR_At5g563701071918.5e-0626.3
TkA05G429720PF29594LRR_SKP21292321.1e-1248.6
TkA05G429720PF25372LRR_FBXL151362169.3e-0831.6
TkA05G429720PF13516LRR_61381570.03215.0
TkA05G429720PF18791Transp_inhibit1801977.6e-2483.7
TkA05G429720PF13516LRR_61881970.03215.0
TkA05G429720PF13516LRR_62162300.03215.0
TkA05G429720PF24758LRR_At5g563702913498.5e-0626.3
TkA05G429720PF29594LRR_SKP22923991.1e-1248.6
TkA05G429720PF13516LRR_63253360.03215.0
TkA05G429720PF25372LRR_FBXL153264099.3e-0831.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O04197Arabidopsis thalianasp|O04197|COI1_ARATH Coronatine-insensitive protein 166.000%Swiss-ProtHigh
Q60EH4Oryza sativa subsp. japonicasp|Q60EH4|COI1B_ORYSJ Coronatine-insensitive protein homolog 1b61.600%Swiss-ProtHigh
A2WX30Oryza sativa subsp. indicasp|A2WX30|COI1A_ORYSI Coronatine-insensitive protein homolog 1a60.300%Swiss-ProtHigh
Q6Y9P5Oryza sativa subsp. japonicasp|Q6Y9P5|COI1A_ORYSJ Coronatine-insensitive protein homolog 1a60.300%Swiss-ProtHigh
A2XEV1Oryza sativa subsp. indicasp|A2XEV1|COI2_ORYSI Coronatine-insensitive protein homolog 257.400%Swiss-ProtHigh

JBrowse

View in Genome Browser