TkA05G429420 | RubberDandelionOmics

Gene overview

TkA05G429420

Reference: TK1151 Chr: Chr05 Coordinates: 107105235-107105669 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

435 bp · TkA05G429420|TK1151|cDNA

ATGGCGAGCCTATGGCGAGCGGTTATGGGCGATTCGCCACCCAACATCGACGATTACGACGGCGTCGAGTACTGGTCAAACCCCGAGCGAACCGGCTGGCTCACCAAGCAAGGCGAGTACATCAAGACCTGGCGCCGCCGTTGGTTCGTTTTGAAACAAGGCAAACTCTTCTGGTTCAAGGAGGCCATCGTAACCCGCGGATCACGTCCCCGTGGCGTCGTACCAGTTGCGACCTGCCTCACAGTCAAAGGGGCCGAAGA...

CDS

Download CDS FASTA

435 bp · TkA05G429420|TK1151|CDS

ATGGCGAGCCTATGGCGAGCGGTTATGGGCGATTCGCCACCCAACATCGACGATTACGACGGCGTCGAGTACTGGTCAAACCCCGAGCGAACCGGCTGGCTCACCAAGCAAGGCGAGTACATCAAGACCTGGCGCCGCCGTTGGTTCGTTTTGAAACAAGGCAAACTCTTCTGGTTCAAGGAGGCCATCGTAACCCGCGGATCACGTCCCCGTGGCGTCGTACCAGTTGCGACCTGCCTCACAGTCAAAGGGGCCGAAGA...

Protein

Download Protein FASTA

144 aa · TkA05G429420|TK1151|PROTEIN

MASLWRAVMGDSPPNIDDYDGVEYWSNPERTGWLTKQGEYIKTWRRRWFVLKQGKLFWFKEAIVTRGSRPRGVVPVATCLTVKGAEDVINKQFAFELSTRSDTMYFIADSEKEKEDWINSIGRSIVQHSRSVTDNEIVDYDSNR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G429420`
TK1151 ID	TkA05G429420
OH-1004 ID	LXL04_012282
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.400
Protein coverage (%)	TK1151 100.000 / OH-1004 40.563 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G429420

Location Chr05:107105235-107105669 (-)

Description Similar to PH1: Pleckstrin homology domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g29700`	Binds specifically to phosphatidylinositol 3-phosphate (PtdIns3P), but not to other phosphoinositides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012282 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001881 receptor recycling Biological Process

GO:0007032 endosome organization Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0046294 formaldehyde catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0055037 recycling endosome Cellular Component

GO:0004022 alcohol dehydrogenase (NAD+) activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G29700

sly:544074

sot:102577519

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.598

Rank 1 · TkA05G429420 · TK1151

Cell membrane0.385

Rank 2 · TkA05G429420 · TK1151

Nucleus0.254

Rank 3 · TkA05G429420 · TK1151

Golgi apparatus0.100

Rank 4 · TkA05G429420 · TK1151

Lysosome / Vacuole0.071

Rank 5 · TkA05G429420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20399PH_2027-97 aa

PF16652PH_1327-36 aa

PF00169PH29-125 aa

PF22697SOS1_NGEF_PH31-64 aa

PF15409PH_832-123 aa

PF15413PH_1136-122 aa

PF15406PH_654-121 aa

PF15410PH_968-121 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G429420	`PF20399`	PH_20	27	97	0.00028	21.5
TkA05G429420	`PF16652`	PH_13	27	36	0.29	11.8
TkA05G429420	`PF00169`	PH	29	125	1.1e-19	71.6
TkA05G429420	`PF22697`	SOS1_NGEF_PH	31	64	0.0095	16.9
TkA05G429420	`PF15409`	PH_8	32	123	0.00082	20.4
TkA05G429420	`PF15413`	PH_11	36	122	0.00029	22.0
TkA05G429420	`PF15406`	PH_6	54	121	0.14	13.2
TkA05G429420	`PF15410`	PH_9	68	121	0.0037	18.2
TkA05G429420	`PF22697`	SOS1_NGEF_PH	80	121	0.0095	16.9
TkA05G429420	`PF16652`	PH_13	80	123	0.29	11.8
TkA05G429420	`PF25321`	PH_RASGAP	88	125	0.0032	18.5
TkA05G429420	`PF08458`	PH_2	90	122	0.016	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ST43`	Arabidopsis thaliana	sp\|Q9ST43\|PH1_ARATH Pleckstrin homology domain-containing protein 1	71.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card