TkA05G423960 | RubberDandelionOmics

Gene overview

TkA05G423960

Reference: TK1151 Chr: Chr05 Coordinates: 105761056-105762893 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

871 bp · TkA05G423960|TK1151|cDNA

AAACTTTTGAGTGACTGGTGGTTGCTAAATAGGAAACGTAGTTCGCTTATTTAAACATCCATCTCTCACTTTATATCTTAGCATCCTTCTCTAGTAGTTCTCTCTACTCTTTTCTCCATTCCAAAGAGTTTCATAATCATTTTTTTTGTGTTGCAGGAATGGTGATGGTGGATGATATCTCTTTTCCTCCACATATCACAGCTACTACCAAGCCTTTATCTTTGCTTGGACATGGAATTACCGATATCGAGATACACTTT...

CDS

Download CDS FASTA

624 bp · TkA05G423960|TK1151|CDS

ATGGTGATGGTGGATGATATCTCTTTTCCTCCACATATCACAGCTACTACCAAGCCTTTATCTTTGCTTGGACATGGAATTACCGATATCGAGATACACTTTTTGCATATTAAATTCACCGCCATCGGAGTTTACATTGATCCAGAGATCATCGGTCATTTGCAAAAATGGAAAGGTAAATCTGGAACTGAGCTAGCCAAAGACGACGATTTCTTCGACTGTGTTATTTCAGCTCCCGTTGACAAGTACTTGAGAATTGT...

Protein

Download Protein FASTA

207 aa · TkA05G423960|TK1151|PROTEIN

MVMVDDISFPPHITATTKPLSLLGHGITDIEIHFLHIKFTAIGVYIDPEIIGHLQKWKGKSGTELAKDDDFFDCVISAPVDKYLRIVVIKEIKGSQYGVQLESAVRDRLADDDKYEEEEEAALAEIVEFLQTKYFKKDSVLTFSFPAASNAVEIGFSSEGKEEPKTMKVENGNVAAMMKKWYLGGTSAYSPSTILSLANNFSEELSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G423960`
TK1151 ID	TkA05G423960
OH-1004 ID	LXL04_039750
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	27.000
Protein coverage (%)	TK1151 91.304 / OH-1004 95.833 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G423960

Location Chr05:105761056-105762893 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g05270`	Involved in anthocyanin biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039750 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006631 fatty acid metabolic process Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005504 fatty acid binding Molecular Function

GO:0016872 intramolecular lyase activity Molecular Function

GO:0045430 chalcone isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G53520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.404

Rank 1 · TkA05G423960 · TK1151

Cytoplasm0.357

Rank 2 · TkA05G423960 · TK1151

Mitochondrion0.192

Rank 3 · TkA05G423960 · TK1151

Peroxisome0.125

Rank 4 · TkA05G423960 · TK1151

Nucleus0.100

Rank 5 · TkA05G423960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02431Chalcone4-203 aa

PF16035Chalcone_220-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G423960	`PF02431`	Chalcone	4	203	3.1e-29	102.6
TkA05G423960	`PF16035`	Chalcone_2	20	193	1.2e-05	26.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZW3`	Arabidopsis thaliana	sp\|Q8VZW3\|CFI3_ARATH Probable chalcone--flavanone isomerase 3	62.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card