TkA05G423120 | RubberDandelionOmics

Gene overview

TkA05G423120

Reference: TK1151 Chr: Chr05 Coordinates: 105486503-105487274 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

685 bp · TkA05G423120|TK1151|cDNA

CAGACAATCAAAAGATGAAAGATCGATATAAAGATTCAAGGAAAGAGGAAGAAGAAGAAGAACATCATATCAATTTGAGGAGCTTGTCAAAGATTATGATCCCTCCGTTGGGTGCTTCATATATACAAAACCATATTCCCTCAAGATCCACCATCATCATATCACCCATGGACTCCAAATATAGGTATTGGCAGACATTAATGGTGGTAATGGTAGCATATTCAGCTTGGACATATCCCTTTGAAGTCGCCTTTCTGAAA...

CDS

Download CDS FASTA

402 bp · TkA05G423120|TK1151|CDS

ATGAAAGATCGATATAAAGATTCAAGGAAAGAGGAAGAAGAAGAAGAACATCATATCAATTTGAGGAGCTTGTCAAAGATTATGATCCCTCCGTTGGGTGCTTCATATATACAAAACCATATTCCCTCAAGATCCACCATCATCATATCACCCATGGACTCCAAATATAGGTATTGGCAGACATTAATGGTGGTAATGGTAGCATATTCAGCTTGGACATATCCCTTTGAAGTCGCCTTTCTGAAATCCTCTGCACAAAC...

Protein

Download Protein FASTA

133 aa · TkA05G423120|TK1151|PROTEIN

MKDRYKDSRKEEEEEEHHINLRSLSKIMIPPLGASYIQNHIPSRSTIIISPMDSKYRYWQTLMVVMVAYSAWTYPFEVAFLKSSAQTHKQLYIADSIVDLFFTADIILTFFVAYVDPITHLLVRDPKSITTSN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G423120`
TK1151 ID	TkA05G423120
OH-1004 ID	LXL04_001355
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 98.496 / OH-1004 15.733 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G423120

Location Chr05:105486503-105487274 (+)

Description Similar to AKT2: Potassium channel AKT2/3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22200`	Highly selective and weak inward-rectifying potassium channel.	Loss of the AKT2/3 potassium channel affects sugar loading into the phloem of Arabidopsis.2002 · DOI: 10.1007/s00425-002-0895-1 Regulated expression of Arabidopsis shaker K+ channel genes involved in K+ uptake and distribution in the plant.2003 · DOI: 10.1023/a:1022597102282
`At2g25600`	Highly selective inward-rectifying potassium channel that could mediate potassium uptake in the pollen membrane.	Pollen tube development and competitive ability are impaired by disruption of a Shaker K(+) channel in Arabidopsis.2002 · DOI: 10.1101/gad.213902

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0428700`	Probable inward-rectifying potassium channel.	No verified direct reference in this release
`Os02g0245800`	Probable inward-rectifying potassium channel.	No verified direct reference in this release
`Os01g0210700`	Probable inward-rectifying potassium channel.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001355 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042391 regulation of membrane potential Biological Process

GO:0048767 root hair elongation Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT2G26650

ath:AT4G22200

ath:AT4G32500

dosa:Os01g0648000

dosa:Os05g0428700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.630

Rank 1 · TkA05G423120 · TK1151

Cytoplasm0.137

Rank 2 · TkA05G423120 · TK1151

Endoplasmic reticulum0.125

Rank 3 · TkA05G423120 · TK1151

Lysosome / Vacuole0.101

Rank 4 · TkA05G423120 · TK1151

Golgi apparatus0.066

Rank 5 · TkA05G423120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520Ion_trans56-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G423120	`PF00520`	Ion_trans	56	115	3e-09	37.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38898`	Arabidopsis thaliana	sp\|Q38898\|AKT2_ARATH Potassium channel AKT2/3	65.200%	Swiss-Prot	High
`Q8GXE6`	Arabidopsis thaliana	sp\|Q8GXE6\|AKT6_ARATH Potassium channel AKT6	48.600%	Swiss-Prot	Medium
`Q75HP9`	Oryza sativa subsp. japonica	sp\|Q75HP9\|AKT2_ORYSJ Potassium channel AKT2	55.200%	Swiss-Prot	High
`Q6K3T2`	Oryza sativa subsp. japonica	sp\|Q6K3T2\|KAT1_ORYSJ Potassium channel KAT1	50.000%	Swiss-Prot	High
`Q5QNI1`	Oryza sativa subsp. japonica	sp\|Q5QNI1\|KAT2_ORYSJ Potassium channel KAT2	50.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card