TkA05G421090 | RubberDandelionOmics

Gene overview

TkA05G421090

Reference: TK1151 Chr: Chr05 Coordinates: 104922765-104925966 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

737 bp · TkA05G421090|TK1151|cDNA

GTTTTGGACATTTGCCCGCGGGCTTCATTGAACTGCGATCAACAAATCAATCTCCTTGACGATTGGTGTTTTCTTCCTTCCTTCCTTCCTTCTTTTTCCCATGATTTTCAATGTTGGAGGACCAAATGTTGTAAAAGATCCGCAGGTAACTGCTGTGGCTTGACCTCCAGAATAGTACTTAATCAATGGGAAATTGTTGCAAATTGTCCTCCCAAGCAGGAGATAATTATAACAAACAATCAACACTTGCGAGCGGAAAA...

CDS

Download CDS FASTA

417 bp · TkA05G421090|TK1151|CDS

ATGGGAAATTGTTGCAAATTGTCCTCCCAAGCAGGAGATAATTATAACAAACAATCAACACTTGCGAGCGGAAAAGTTGCCCTTATAGAAACCCTAGCAAAATGGGAAGAAAAGGTCTCAGAAGCAAAGAGAAGCGGGAAGATGGTCGTGGTGAATTTTAGTGCATCATGGTGTAGTCCTTGTCGGGTGATAGCGCAACCATACTGCAATCTTGCTGCTATATATGAGTCGCTTGTGTTCTTGACGGTGGATGTTGATGA...

Protein

Download Protein FASTA

138 aa · TkA05G421090|TK1151|PROTEIN

MGNCCKLSSQAGDNYNKQSTLASGKVALIETLAKWEEKVSEAKRSGKMVVVNFSASWCSPCRVIAQPYCNLAAIYESLVFLTVDVDELSAFSTSWEIKATPTFLFLKDGREADRLVGADVEELVNKTEAFAAANYQPR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G421090`
TK1151 ID	TkA05G421090
OH-1004 ID	LXL04_000096
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	47.000
Protein coverage (%)	TK1151 97.101 / OH-1004 90.476 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G421090

Location Chr05:104922765-104925966 (+)

Description Similar to Thioredoxin H-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40790`	Possesses low disulfide reductase activity, but efficient protein disulfide isomerase activity.	AtCXXS: atypical members of the Arabidopsis thaliana thioredoxin h family with a remarkably high disulfide isomerase activity.2008 · DOI: 10.1111/j.1399-3054.2008.01093.x
`At3g56420`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release
`At3g08710`	Probable thiol-disulfide oxidoreductase that may play a role in intercellular communication due to its ability to move from cell to cell.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0168200`	Probable thiol-disulfide oxidoreductase that may be involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000096 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007154 cell communication Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT3G08710

ath:AT3G56420

dosa:Os01g0168200

dosa:Os05g0169000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.385

Rank 1 · TkA05G421090 · TK1151

Nucleus0.239

Rank 2 · TkA05G421090 · TK1151

Cell membrane0.187

Rank 3 · TkA05G421090 · TK1151

Endoplasmic reticulum0.154

Rank 4 · TkA05G421090 · TK1151

Golgi apparatus0.145

Rank 5 · TkA05G421090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13098Thioredoxin_22-21 aa

PF19714DUF62094-65 aa

PF00085Thioredoxin30-126 aa

PF13899Thioredoxin_732-90 aa

PF08534Redoxin33-66 aa

PF03190Thioredox_DsbH35-73 aa

PF13098Thioredoxin_236-118 aa

PF00578AhpC-TSA37-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G421090	`PF13098`	Thioredoxin_2	2	21	3.1e-09	37.9
TkA05G421090	`PF19714`	DUF6209	4	65	0.028	14.9
TkA05G421090	`PF00085`	Thioredoxin	30	126	1.5e-19	70.6
TkA05G421090	`PF13899`	Thioredoxin_7	32	90	5.8e-08	33.5
TkA05G421090	`PF08534`	Redoxin	33	66	0.0033	17.9
TkA05G421090	`PF03190`	Thioredox_DsbH	35	73	0.17	12.5
TkA05G421090	`PF13098`	Thioredoxin_2	36	118	3.1e-09	37.9
TkA05G421090	`PF00578`	AhpC-TSA	37	89	0.0023	18.6
TkA05G421090	`PF13905`	Thioredoxin_8	46	86	0.0027	18.8
TkA05G421090	`PF13905`	Thioredoxin_8	79	107	0.0027	18.8
TkA05G421090	`PF20207`	PedC-like	84	119	0.21	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXV2`	Arabidopsis thaliana	sp\|Q8GXV2\|CXXS2_ARATH Thioredoxin-like protein CXXS2	47.700%	Swiss-Prot	Medium
`Q9LXZ8`	Arabidopsis thaliana	sp\|Q9LXZ8\|TRH10_ARATH Putative thioredoxin H10	53.700%	Swiss-Prot	High
`Q9C9Y6`	Arabidopsis thaliana	sp\|Q9C9Y6\|TRXH9_ARATH Thioredoxin H9	49.600%	Swiss-Prot	Medium
`Q9AS75`	Oryza sativa subsp. japonica	sp\|Q9AS75\|TRH41_ORYSJ Thioredoxin H4-1	46.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card