TkA05G419380 | RubberDandelionOmics

Gene overview

TkA05G419380

Reference: TK1151 Chr: Chr05 Coordinates: 104467889-104471282 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2904 bp · TkA05G419380|TK1151|cDNA

ATGGCCATAGAACGATTGGCCATTACTCAGTTCAAGAACAATCTCGTGGACAAAGCCAACCGTCTCTCGTCTTGGTCCGGGGAAGACTGTTGTAGTTGGTCAGGTGTCGTATGTGATAAGTTCACCCACCATGTCCAAGAGCTTCGCCTTCAAGAAGCGAAAAGCCAAATGTTAGGAGGAATTATAAGTCCTTCTTTGATCAAGTTAGAACAACTTGAGTACCTAGACTTGAGTTGCAACGATTTTGGATTCATTCGCAT...

CDS

Download CDS FASTA

2904 bp · TkA05G419380|TK1151|CDS

ATGGCCATAGAACGATTGGCCATTACTCAGTTCAAGAACAATCTCGTGGACAAAGCCAACCGTCTCTCGTCTTGGTCCGGGGAAGACTGTTGTAGTTGGTCAGGTGTCGTATGTGATAAGTTCACCCACCATGTCCAAGAGCTTCGCCTTCAAGAAGCGAAAAGCCAAATGTTAGGAGGAATTATAAGTCCTTCTTTGATCAAGTTAGAACAACTTGAGTACCTAGACTTGAGTTGCAACGATTTTGGATTCATTCGCAT...

Protein

Download Protein FASTA

967 aa · TkA05G419380|TK1151|PROTEIN

MAIERLAITQFKNNLVDKANRLSSWSGEDCCSWSGVVCDKFTHHVQELRLQEAKSQMLGGIISPSLIKLEQLEYLDLSCNDFGFIRIPAFIGSLENLRYLDISNSQFRGNIPHQLGNLSSLLVLDAHTYEFDYLVSTNLKWIENLKQLQYLDMGGIELTESSNWLQALNTLPSLQELHLSSCGLTLHPSHPRRTVNFTSLIILDISHNYFDGLLPEWVSTLHKLIALDLSGCSSLGIIGQGGFDSIPSLRTPHIIENTFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G419380`
TK1151 ID	TkA05G419380
OH-1004 ID	LXL04_008334
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	64.700
Protein coverage (%)	TK1151 98.966 / OH-1004 98.749 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G419380

Location Chr05:104467889-104471282 (+)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9ZUK7`	Receptor-like protein 18.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008334 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0007165 signal transduction Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G13920

ath:AT5G49290

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.852

Rank 1 · TkA05G419380 · TK1151

Endoplasmic reticulum0.087

Rank 2 · TkA05G419380 · TK1151

Cytoplasm0.060

Rank 3 · TkA05G419380 · TK1151

Nucleus0.047

Rank 4 · TkA05G419380 · TK1151

Lysosome / Vacuole0.024

Rank 5 · TkA05G419380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_24-39 aa

PF24758LRR_At5g5637043-107 aa

PF23598LRR_1458-180 aa

PF23211LRR_LRWD162-121 aa

PF12799LRR_463-82 aa

PF25013LRR_Zer-165-109 aa

PF25013LRR_Zer-166-161 aa

PF00560LRR_171-90 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G419380	`PF08263`	LRRNT_2	4	39	8.2e-11	42.7
TkA05G419380	`PF24758`	LRR_At5g56370	43	107	0.016	15.6
TkA05G419380	`PF23598`	LRR_14	58	180	2.2e-43	149.1
TkA05G419380	`PF23211`	LRR_LRWD1	62	121	4.8e-07	30.4
TkA05G419380	`PF12799`	LRR_4	63	82	2.4e-41	139.5
TkA05G419380	`PF25013`	LRR_Zer-1	65	109	2.1e-09	38.3
TkA05G419380	`PF25013`	LRR_Zer-1	66	161	2.1e-09	38.3
TkA05G419380	`PF00560`	LRR_1	71	90	1.2e-65	203.8
TkA05G419380	`PF13855`	LRR_8	71	125	2.4e-55	184.8
TkA05G419380	`PF12799`	LRR_4	71	106	2.4e-41	139.5
TkA05G419380	`PF13516`	LRR_6	72	83	0.0023	18.6
TkA05G419380	`PF00560`	LRR_1	96	118	1.2e-65	203.8
TkA05G419380	`PF12799`	LRR_4	96	125	2.4e-41	139.5
TkA05G419380	`PF13516`	LRR_6	96	106	0.0023	18.6
TkA05G419380	`PF06863`	DUF1254	99	136	0.083	13.8
TkA05G419380	`PF13855`	LRR_8	133	184	2.4e-55	184.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUK7`	Arabidopsis thaliana	sp\|Q9ZUK7\|RLP18_ARATH Receptor-like protein 18	28.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card