TkA05G418620 | RubberDandelionOmics

Gene overview

TkA05G418620

Reference: TK1151 Chr: Chr05 Coordinates: 104265006-104271182 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1436 bp · TkA05G418620|TK1151|cDNA

ACGCTTTGTATAAGGATTTTCGTTGCTTTCGTTTTTGGAATCAGCCCTGCAAAACTTGCGTTTGCCCCAAATACGTTCAATTCCAACTATCTTCTTCACATAATTTTTCTGCTTGATTTCCACTTGCGACAGACATTGCAAAGCTCTGCTGATTGGAAATTTGGAGCAGAACAGTTTGTCAAGTCATTACCAGACAAAGTATTTGTTCATCGCAGTGAAAAGAACGCTTCATCTCAGACACTAGATGGTGTAGATGTAAT...

CDS

Download CDS FASTA

1053 bp · TkA05G418620|TK1151|CDS

ACGCTTTGTATAAGGATTTTCGTTGCTTTCGTTTTTGGAATCAGCCCTGCAAAACTTGCGTTTGCCCCAAATACGTTCAATTCCAACTATCTTCTTCACATAATTTTTCTGCTTGATTTCCACTTGCGACAGACATTGCAAAGCTCTGCTGATTGGAAATTTGGAGCAGAACAGTTTGTCAAGTCATTACCAGACAAAGTATTTGTTCATCGCAGTGAAAAGAACGCTTCATCTCAGACACTAGATGGTGTAGATGTAAT...

Protein

Download Protein FASTA

350 aa · TkA05G418620|TK1151|PROTEIN

TLCIRIFVAFVFGISPAKLAFAPNTFNSNYLLHIIFLLDFHLRQTLQSSADWKFGAEQFVKSLPDKVFVHRSEKNASSQTLDGVDVMGERLSQEILEVIKEKPNLKKISFVAHSVGGLVARYTIGRLYRPPLIKDSEELKATIGGLIPVNFITVATPHLGSRGNKQVPFLFGVSALEKVAVAIIHWIFRRTGRHLFLTDNEDGKPPLLKRMLEDYGDLYFMSALRSFHRRVAYANVGYDHIVGWRTSSIRRNIELPKWED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G418620`
TK1151 ID	TkA05G418620
OH-1004 ID	LXL04_028321
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	55.400
Protein coverage (%)	TK1151 81.714 / OH-1004 71.322 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G418620`
Location	Chr05:104265006-104271182 (+)
Description	Similar to SPAC4A8.10: Putative lipase C4A8.10 (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028321` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0016042 lipid catabolic process Biological Process GO:0055088 lipid homeostasis Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005811 lipid droplet Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0004622 phosphatidylcholine lysophospholipase A1 activity Molecular Function GO:0004623 A2-type glycerophospholipase activity Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	sce:YDL109C sce:YDR444W sce:YGL144C sce:YOR059C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.263

Rank 1 · TkA05G418620 · TK1151

Cytoplasm0.232

Rank 2 · TkA05G418620 · TK1151

Golgi apparatus0.181

Rank 3 · TkA05G418620 · TK1151

Nucleus0.138

Rank 4 · TkA05G418620 · TK1151

Mitochondrion0.138

Rank 5 · TkA05G418620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05057DUF67648-248 aa

PF02089Palm_thioest61-131 aa

PF01764Lipase_372-160 aa

PF07819PGAP193-124 aa

PF01674Lipase_295-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G418620	`PF05057`	DUF676	48	248	2.2e-62	211.2
TkA05G418620	`PF02089`	Palm_thioest	61	131	0.093	13.1
TkA05G418620	`PF01764`	Lipase_3	72	160	0.064	13.9
TkA05G418620	`PF07819`	PGAP1	93	124	0.0074	16.8
TkA05G418620	`PF01674`	Lipase_2	95	147	0.28	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card