Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1902 bp · TkA05G418570|TK1151|cDNA
ATGGAAGGGTCTCACAAAACAGTTGATGAAGCTGAAAGTAGAAGTAAGGAACCTGATTCGGTTCCAATTGTTGATGTTGAAGAAGAGGAGGAAGAAGTTGCAGAAAATAAAGGTGGTCATAGAAGTAAGGAACCTGATTCGGTTCCAAACCGACGGGTTCAAACCCAAAACCAACGGTTTCAAACCCAACCCATCAGTCTGTGGGTTCAACCCACAAAACCGAGAAACCGAGTTCAGAACCCAAGAAACCGAACCCGCCC...
1902 bp · TkA05G418570|TK1151|CDS
ATGGAAGGGTCTCACAAAACAGTTGATGAAGCTGAAAGTAGAAGTAAGGAACCTGATTCGGTTCCAATTGTTGATGTTGAAGAAGAGGAGGAAGAAGTTGCAGAAAATAAAGGTGGTCATAGAAGTAAGGAACCTGATTCGGTTCCAAACCGACGGGTTCAAACCCAAAACCAACGGTTTCAAACCCAACCCATCAGTCTGTGGGTTCAACCCACAAAACCGAGAAACCGAGTTCAGAACCCAAGAAACCGAACCCGCCC...
Protein
Download Protein FASTA633 aa · TkA05G418570|TK1151|PROTEIN
MEGSHKTVDEAESRSKEPDSVPIVDVEEEEEEVAENKGGHRSKEPDSVPNRRVQTQNQRFQTQPISLWVQPTKPRNRVQNPRNRTRPETEFIGFKNPETDFGGLGSSQEGRREEYSGPPEMVPDIGGRSRRRFLVGCASEMVPSSRRLYHRVRRVAGWTEDSQAAGIRRRRRLKPFKQTGPCCFSPNARYLAVAVDYRLVIRDVLSLKVVQLFSCMDKITYIEWALDSEYILCGLYKKPMIQAWSLAQPEWTCKIDEGPA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G418570 |
|---|---|
| TK1151 ID | TkA05G418570 |
| OH-1004 ID | LXL04_021750 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G418570 |
|---|---|
| Location | Chr05:104244076-104249206 (+) |
| Description | Similar to WRAP73: WD repeat-containing protein WRAP73 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000070 mitotic sister chromatid segregation Biological Process GO:0030030 cell projection organization Biological Process GO:0090307 mitotic spindle assembly Biological Process GO:1902857 positive regulation of non-motile cilium assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005813 centrosome Cellular Component GO:0005814 centriole Cellular Component GO:0005815 microtubule organizing center Cellular Component GO:0005829 cytosol Cellular Component GO:0034451 centriolar satellite Cellular Component GO:0036064 ciliary basal body Cellular Component |
| KEGG gene cross-reference | hsa:49856 mmu:59002 spo:2540228 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24817WD40_WDHD1_1st180-229 aaPF25174Beta-prop_THOC3182-361 aaPF00400WD40182-196 aaPF23342WDR90_beta-prop_4th182-201 aaPF23381Beta-prop_IFT122_1st183-363 aaPF23414Beta-prop_EML_2183-233 aaPF12894ANAPC4_WD40183-225 aaPF25168Beta-prop_WDR36-Utp21_2nd183-230 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G418570 | PF24817 | WD40_WDHD1_1st | 180 | 229 | 6.9e-13 | 49.1 |
| TkA05G418570 | PF25174 | Beta-prop_THOC3 | 182 | 361 | 4e-22 | 79.2 |
| TkA05G418570 | PF00400 | WD40 | 182 | 196 | 1.7e-11 | 44.8 |
| TkA05G418570 | PF23342 | WDR90_beta-prop_4th | 182 | 201 | 0.081 | 12.7 |
| TkA05G418570 | PF23381 | Beta-prop_IFT122_1st | 183 | 363 | 1.1e-23 | 84.6 |
| TkA05G418570 | PF23414 | Beta-prop_EML_2 | 183 | 233 | 8.5e-11 | 42.4 |
| TkA05G418570 | PF12894 | ANAPC4_WD40 | 183 | 225 | 3.9e-09 | 37.3 |
| TkA05G418570 | PF25168 | Beta-prop_WDR36-Utp21_2nd | 183 | 230 | 0.00031 | 20.9 |
| TkA05G418570 | PF25175 | Beta-prop_WDR5 | 184 | 233 | 2.6e-16 | 60.5 |
| TkA05G418570 | PF24807 | WD40_CDC20-Fz | 185 | 281 | 1.8e-11 | 44.6 |
| TkA05G418570 | PF24814 | WD40_Prp19 | 186 | 362 | 3.4e-09 | 36.9 |
| TkA05G418570 | PF23389 | Beta-prop_WDR19_1st | 187 | 274 | 3.3e-06 | 27.1 |
| TkA05G418570 | PF08662 | eIF2A | 203 | 232 | 6.7e-07 | 30.1 |
| TkA05G418570 | PF25173 | Beta-prop_WDR3_1st | 208 | 324 | 1.2e-06 | 29.1 |
| TkA05G418570 | PF25460 | Beta-prop_Aladin | 216 | 321 | 2.2e-11 | 44.2 |
| TkA05G418570 | PF00400 | WD40 | 217 | 234 | 1.7e-11 | 44.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.