TkA05G417590 | RubberDandelionOmics

Gene overview

TkA05G417590

Reference: TK1151 Chr: Chr05 Coordinates: 103955451-103958119 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

642 bp · TkA05G417590|TK1151|cDNA

ATGGCGTATCTAAAGCTAAGTTTGGTTTTGCTTGTGGCAATGGTTGTTGCATCCATGAACTTTGAGTTTTCCGGTGCAAAAGAAGTGCATATGGTTGGTGATTTATTCGGCTGGGATATACCACATAATAATGATACTGTCTATGTTAGGTGGTCACAAAACAATCACTTCAAAGTCAATGATCAACTTGTATTTAACTTCGCGATAGCACTTCACACAGTCGCAGAAGTAACAGAGACGGCATATAATAACTGCGACAA...

CDS

Download CDS FASTA

642 bp · TkA05G417590|TK1151|CDS

ATGGCGTATCTAAAGCTAAGTTTGGTTTTGCTTGTGGCAATGGTTGTTGCATCCATGAACTTTGAGTTTTCCGGTGCAAAAGAAGTGCATATGGTTGGTGATTTATTCGGCTGGGATATACCACATAATAATGATACTGTCTATGTTAGGTGGTCACAAAACAATCACTTCAAAGTCAATGATCAACTTGTATTTAACTTCGCGATAGCACTTCACACAGTCGCAGAAGTAACAGAGACGGCATATAATAACTGCGACAA...

Protein

Download Protein FASTA

213 aa · TkA05G417590|TK1151|PROTEIN

MAYLKLSLVLLVAMVVASMNFEFSGAKEVHMVGDLFGWDIPHNNDTVYVRWSQNNHFKVNDQLVFNFAIALHTVAEVTETAYNNCDKQNPISIHYQTPTIITLTRPVAVPHSQTTTQSTATPSLYQPYDPPLLCSSEKEEDSACCCMFRRLSDGIRRRQNRHGELFWLGSHDDHRRLPPAAVLRPTIMNGVDWVFLHLVKIDFDGFHSGRFSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G417590`
TK1151 ID	TkA05G417590
OH-1004 ID	LXL04_021728
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G417590

Location Chr05:103955451-103958119 (+)

Description Similar to Blue copper protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20230`	Probably acts as an electron carrier.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021728 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002239 response to oomycetes Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009646 response to absence of light Biological Process

GO:0015690 aluminum cation transport Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1901141 regulation of lignin biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT1G79800

ath:AT2G25060

ath:AT5G20230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.292

Rank 1 · TkA05G417590 · TK1151

Endoplasmic reticulum0.223

Rank 2 · TkA05G417590 · TK1151

Cell membrane0.204

Rank 3 · TkA05G417590 · TK1151

Cytoplasm0.164

Rank 4 · TkA05G417590 · TK1151

Nucleus0.116

Rank 5 · TkA05G417590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02298Cu_bind_like38-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G417590	`PF02298`	Cu_bind_like	38	106	5.7e-15	55.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q07488`	Arabidopsis thaliana	sp\|Q07488\|BCB1_ARATH Blue copper protein	41.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card