Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2436 bp · TkA05G417310|TK1151|cDNA
AAACCATGTGGCATAACTATAATTTAGTAACCAGCTAACTACCATCTTTTTGGACGGAACTCCATGGAGCCCTAGATATGTTATCATGTTAATCTGCCATATCCATTGATGGAAATCAAGCTCTATTTCCATGGCGATTATTGTCTACCCCAGCATTCCAACTGCCTTGCTCTTGCAAAATCGTCGTCGATCAGTTCTACCAACTCCGGTCCGGTGTTCTTCTTCCGGCACTGTAACATCCCCCACGTCTAAGGTAATAA...
2142 bp · TkA05G417310|TK1151|CDS
ATGGCGATTATTGTCTACCCCAGCATTCCAACTGCCTTGCTCTTGCAAAATCGTCGTCGATCAGTTCTACCAACTCCGGTCCGGTGTTCTTCTTCCGGCACTGTAACATCCCCCACGTCTAAGGTAATAACAAGTTCCAATGGCGGAAAAAGCACGGGCGCTGCAGTTCTCTGGTACAAGAATGATCTTCGTGTCGATGACCATCCAGGTTTAATTGCTGCCTCCAAACATACTGTGGTTGTTCCTCTTTATGTCTTCGA...
Protein
Download Protein FASTA713 aa · TkA05G417310|TK1151|PROTEIN
MAIIVYPSIPTALLLQNRRRSVLPTPVRCSSSGTVTSPTSKVITSSNGGKSTGAAVLWYKNDLRVDDHPGLIAASKHTVVVPLYVFDHRILRYFTEEMLELLLFAVKDLRKSLKDVGSDLMIRSGRTESVIHDLVKEVRAANIYTEAEVEYDLQLVIEKVKDNLGDIKSPKLSLWSTPFYDIKNIMEIPLSYDKFQQLKLSVNSPLSSPKLHGTSTDLTWGTLPTLNDLKKLINDNPYKSKDSWTSIKNNSAESILQNAR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G417310 |
|---|---|
| TK1151 ID | TkA05G417310 |
| OH-1004 ID | LXL04_021716 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 94.900 |
| Protein coverage (%) | TK1151 99.860 / OH-1004 99.021Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G417310 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:103864633-103875254 (+) | |||||||||
| Description | Similar to PPH: Pheophytinase, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000719 photoreactive repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0015996 chlorophyll catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0009507 chloroplast Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009536 plastid Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0003677 DNA binding Molecular Function GO:0003729 mRNA binding Molecular Function GO:0003904 deoxyribodipyrimidine photo-lyase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G47590 ath:AT5G13800 ath:AT5G24850 gvi:glr0835 nph:NP_3456A These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00875DNA_photolyase55-185 aaPF12146Hydrolase_462-134 aaPF00561Abhydrolase_1436-542 aaPF12146Hydrolase_4437-553 aaPF11144DUF2920437-456 aaPF12697Abhydrolase_6438-680 aaPF11144DUF2920502-537 aaPF00561Abhydrolase_1618-674 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G417310 | PF00875 | DNA_photolyase | 55 | 185 | 2.1e-19 | 70.8 |
| TkA05G417310 | PF12146 | Hydrolase_4 | 62 | 134 | 2.7e-07 | 30.9 |
| TkA05G417310 | PF00561 | Abhydrolase_1 | 436 | 542 | 6.8e-18 | 65.9 |
| TkA05G417310 | PF12146 | Hydrolase_4 | 437 | 553 | 2.7e-07 | 30.9 |
| TkA05G417310 | PF11144 | DUF2920 | 437 | 456 | 0.21 | 11.4 |
| TkA05G417310 | PF12697 | Abhydrolase_6 | 438 | 680 | 5.6e-17 | 63.8 |
| TkA05G417310 | PF11144 | DUF2920 | 502 | 537 | 0.21 | 11.4 |
| TkA05G417310 | PF00561 | Abhydrolase_1 | 618 | 674 | 6.8e-18 | 65.9 |
| TkA05G417310 | PF11144 | DUF2920 | 628 | 663 | 0.21 | 11.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.